Proteintech, 87175-3-RR, ERCC1 Recombinant monoclonal antibody

Size: 20ul / 100ul The ERCC1 (87175-3-RR) by Proteintech is a Recombinant antibody targeting ERCC1 in WB, IF/ICC, ELISA applications with reactivity to human samples 87175-3-RR targets ERCC1 in WB, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HeLa cells, HepG2 cells, MCF-7 cells, SKOV-3 cells, T-47D cells, HCT 116 cells, COLO 320 cells Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Immunofluorescence (IF)/ICC: IF/ICC : 1:400-1:1600 Background Information Excision Repair Cross Complementing 1 (ERCC1) is a structure-specific endonuclease that is responsible for the 5'-incision during DNA repair. It forms a complex with ERCC11, XPF and ERCC4, which are required in both recombinatorial repair and nucleotide excision repair. It has been found that ERCC1, together with RRM1, are determinants of survival after surgical treatment of early-stage, non-small-cell lung cancer. (Ref: Simon, ER. 2005). The calculated molecular weight of ERCC1 is 33 kDa, but the modified ERCC1 is about38 kDa. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag6112 Product name: Recombinant human ERCC1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-323 aa of BC052813 Sequence: MDPGKDKEGVPQPSGPPARKKFVIPLDEDEVPPGVAKPLFRSTQSLPTVDTSAQAAPQTYAEYAISQPLEGAGATCPTGSEPLAGETPNQALKPGAKSNSIIVSPRQRGNPVLKFVRNVPWEFGDVIPDYVLGQSTCALFLSLRYHNLHPDYIHGRLQSLGKNFALRVLLVQVDVKDPQQALKELAKMCILADCTLILAWSPEEAGRYLETYKAYEQKPADLLMEKLEQDFVSRVTECLTTVKSVNKTDSQTLLTTFGSLEQLIAASREDLALCPGLGPQKVRALGKNPRSWGKERAPNKHNLRPQSFKVKKEPKTRHSGFRL Predict reactive species Full Name: excision repair cross-complementing rodent repair deficiency, complementation group 1 (includes overlapping antisense sequence) Calculated Molecular Weight: 33 kDa Observed Molecular Weight: 40 kDa GenBank Accession Number: BC052813 Gene Symbol: ERCC1 Gene ID (NCBI): 2067 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P07992 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.