Proteintech, 87239-1-RR, ANKRD13A Recombinant monoclonal antibody

Size: 20ul / 100ul The ANKRD13A (87239-1-RR) by Proteintech is a Recombinant antibody targeting ANKRD13A in WB, ELISA applications with reactivity to human samples 87239-1-RR targets ANKRD13A in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: MCF-7 cells, HepG2 cells, OVCAR-3 cells Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Background Information ANKRD13A, also named ANKRD13, is a 590 amino acid protein that contains two ANK repeats and four UIM (ubiquitin-interacting motif) repeats. ANKRD13A localizes in the cell membrane. ANKRD13A is an ubiquitin-binding protein that specifically recognizes and binds 'Lys-63'-linked ubiquitin, but does not bind 'Lys-48'-linked ubiquitin. ANKRD13A positively regulates the internalization of ligand-activated EGFR by binding to the Ub moiety of ubiquitinated EGFR at the cell membrane. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag21200 Product name: Recombinant human ANKRD13A protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 499-590 aa of BC032833 Sequence: SSRSQELSGPASNGGISQTNTYDAQYERAIQESLLTSTEGLCPSALSETSRFDNDLQLAMELSAKELEEWELRLQEEEAELQQVLQLSLTDK Predict reactive species Full Name: ankyrin repeat domain 13A Calculated Molecular Weight: 590 aa, 68 kDa Observed Molecular Weight: 80 kDa GenBank Accession Number: BC032833 Gene Symbol: ANKRD13A Gene ID (NCBI): 88455 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q8IZ07 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.