Proteintech, 87270-2-RR, CPOX Recombinant monoclonal antibody

Size: 20ul / 100ul The CPOX (87270-2-RR) by Proteintech is a Recombinant antibody targeting CPOX in WB, ELISA applications with reactivity to human, mouse samples 87270-2-RR targets CPOX in WB, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: HCT 116 cells, LNCaP cells, Jurkat cells, K-562 cells, mouse liver tissue Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Background Information CPOX(Coproporphyrinogen-III oxidase, mitochondrial) is also named as CPO and CPX. Human CPO is a 76 kDa protein that is active as a homodimer in the mitochondrial intermembrane pace(PMID:16159891).Mutations in human CPO gene predict the clinical outcome of the disease, with either hepatic hereditary coproporphyria or hematological manifestations of erythropoietic harderoporphyria.CPOX has a transit peptide of 110 aa and the chain contains 344 aa. Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag2858 Product name: Recombinant human CPOX protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-303 aa of BC023551 Sequence: MALQLGRLSSGPCWLVARGGCGGPRAWSQCGGGGLRAWSQRSAAGRVCRPPGPAGTEQSRGLGHGSTSRGGPWVGTGLAAALAGLVGLATAAFGHVQRAEMLPKTSGTRATSLGRPEEEEDELAHRCSSFMAPPVTDLGELRRRPGDMKTKMELLILETQAQVCQALAQVDGGANFSVDRWERKEGGGGISCVLQDGCVFEKAGVSISVVHGNLSEEAAKQMRSRGKVLKTKDGKLPFCAMGVSSVIHPKNPHAPTIHFNYRYFEVEEADGNKQWWFGGGCDLTPTYLNQEDAVHFHRTLKEA Predict reactive species Full Name: coproporphyrinogen oxidase Calculated Molecular Weight: 454 aa, 50 kDa Observed Molecular Weight: 36 kDa GenBank Accession Number: BC023551 Gene Symbol: CPOX Gene ID (NCBI): 1371 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P36551 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.