Iright
BRAND / VENDOR: Proteintech

Proteintech, 87271-4-RR, Caspase 1 Recombinant monoclonal antibody

CATALOG NUMBER: 87271-4-RR
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 100ul The Caspase 1 (87271-4-RR) by Proteintech is a Recombinant antibody targeting Caspase 1 in WB, ELISA applications with reactivity to mouse samples 87271-4-RR targets Caspase 1 in WB, ELISA applications and shows reactivity with mouse samples. Tested Applications Positive WB detected in: mouse heart tissue, mouse skeletal muscle tissue Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Background Information CASP1(caspase-1) is also named as IL1BC, IL1BCE and belongs to the peptidase C14A family. It is a cysteine protease that regulates inflammatory processes through its capacity to process and activate the interleukin-1-beta (IL1B), IL18, and IL33 precursor proteins. The active caspase-1 can increase cellular membrane permeability and intracellular calcium levels, which facilitates lysosome exocytosis and release of host antimicrobial factors and microbial products (PMID:21804020). 87271-4-RR is designed for mouse caspase 1. Specification Tested Reactivity: mouse Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag34441 Product name: Recombinant mouse Casp1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 119-296 aa of BC008152 Sequence: DNPAMPTSSGSEGNVKLCSLEEAQRIWKQKSAEIYPIMDKSSRTRLALIICNEEFDSIPRRTGAEVDITGMTMLLQNLGYSVDVKKNLTASDMTTELEAFAHRPEHKTSDSTFLVFMSHGIREGICGKKHSEQVPDILQLNAIFNMLNTKNCPSLKDKPKVIIIQACRGDSPGVVWFK Predict reactive species Full Name: caspase 1 Observed Molecular Weight: 45 kDa GenBank Accession Number: BC008152 Gene Symbol: Caspase 1 Gene ID (NCBI): 12362 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P29452 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924