Proteintech, 87275-3-RR, GPVI Recombinant monoclonal antibody

Size: 20ul / 100ul The GPVI (87275-3-RR) by Proteintech is a Recombinant antibody targeting GPVI in WB, ELISA applications with reactivity to human samples 87275-3-RR targets GPVI in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: human peripheral blood platelets Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg6474 Product name: Recombinant human GPVI protein Source: mammalian cells -derived, V37 Tag: C-rFc Domain: 21-276 aa of NM_016363.5 Sequence: QSGPLPKPSLQALPSSLVPLEKPVTLRCQGPPGVDLYRLEKLSSSRYQDQAVLFIPAMKRSLAGRYRCSYQNGSLWSLPSDQLELVATGVFAKPSLSAQPGPAVSSGGDVTLQCQTRYGFDQFALYKEGDPAPYKNPERWYRASFPIITVTAAHSGTYRCYSFSSRDPYLWSAPSDPLELVVTGTSVTPSRLPTEPPSPVAEFSEATAELTVSFTNEVFTTETSRSITASPKESDSPAGPARQYYTKGNLVRICLG Predict reactive species Full Name: glycoprotein VI (platelet) Calculated Molecular Weight: 37 kDa Observed Molecular Weight: 58 kDa GenBank Accession Number: NM_016363.5 Gene Symbol: GP6 Gene ID (NCBI): 51206 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q9HCN6 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.