Iright
BRAND / VENDOR: Proteintech

Proteintech, 87367-3-RR, TNFSF15 Recombinant monoclonal antibody

CATALOG NUMBER: 87367-3-RR
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 100ul The TNFSF15 (87367-3-RR) by Proteintech is a Recombinant antibody targeting TNFSF15 in WB, IF/ICC, ELISA applications with reactivity to mouse samples 87367-3-RR targets TNFSF15 in WB, IF/ICC, ELISA applications and shows reactivity with mouse samples. Tested Applications Positive WB detected in: Mouse TNFSF15 Transfected HEK-293T cells Positive IF/ICC detected in: Transfected HEK-293 cells Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Specification Tested Reactivity: mouse Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg5273 Product name: Recombinant Mouse TNFSF15 protein (rFc Tag) Source: mammalian cells -derived, V37 Tag: C-rFc Domain: 61-252 aa of / Sequence: AGQLRVPGKDCMLRAITEERSEPSPQQVYSPPRGKPRAHLTIKKQTPAPHLKNQLSALHWEHDLGMAFTKNGMKYINKSLVIPESGDYFIYSQITFRGTTSVCGDISRGRRPNKPDSITVVITKVADSYPEPARLLTGSKSVCEISNNWFQSLYLGAMFSLEEGDRLMVNVSDISLVDYTKEDKTFFGAFLL Predict reactive species Full Name: tumor necrosis factor (ligand) superfamily, member 15 Calculated Molecular Weight: 28 kDa Observed Molecular Weight: 35 kDa GenBank Accession Number: / Gene Symbol: Tnfsf15 Gene ID (NCBI): 326623 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q5UBV8 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924