Iright
BRAND / VENDOR: Proteintech

Proteintech, 87369-1-RR, ALKBH1 Recombinant monoclonal antibody

CATALOG NUMBER: 87369-1-RR
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 100ul The ALKBH1 (87369-1-RR) by Proteintech is a Recombinant antibody targeting ALKBH1 in WB, IF/ICC, ELISA applications with reactivity to human, mouse samples 87369-1-RR targets ALKBH1 in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: HEK-293T cells, RAW 264.7 cells, K-562 cells, A549 cells, NIH/3T3 cells Positive IF/ICC detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information Two RNA m6A demethylases, FTO and ALKBH5, have been identified since 2011, with both capable of removing the methyl group of m6A on poly-adenylated RNA through an iron-dependent oxidative demethylation mechanism. ALKBH1 as a RNA demethylase that mediates removal of the methyl group from N1-methyladenosine (m1A) in tRNA. ALKBH1 can tune translation initiation and elongation by regulating the cellular levels of tRNAiMet and the association of other ALKBH1 target tRNAs to polysomes, thereby affecting protein synthesis. Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag27520 Product name: Recombinant human ALKBH1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 15-169 aa of BC025787 Sequence: ATEPGEDAFRKLFRFYRQSRPGTADLEGVIDFSAAHAARGKGPGAQKVIKSQLNVSSVSEQNAYRAGLQPVSKWQAYGLKGYPGFIFIPNPFLPGYQWHWVKQCLKLYSQKPNVCNLDKHMSKEETQDLWEQSKEFLRYKEATKRRPRSLLEKLR Predict reactive species Full Name: alkB, alkylation repair homolog 1 (E. coli) Calculated Molecular Weight: 389 aa, 44 kDa Observed Molecular Weight: 44 kDa GenBank Accession Number: BC025787 Gene Symbol: ALKBH1 Gene ID (NCBI): 8846 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q13686 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924