Proteintech, 87376-1-RR, CCL4L1 Recombinant monoclonal antibody

Size: 20ul / 100ul The CCL4L1 (87376-1-RR) by Proteintech is a Recombinant antibody targeting CCL4L1 in WB, ELISA applications with reactivity to human samples 87376-1-RR targets CCL4L1 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: PMA, LPS and Brefeldin A treated THP-1 cells Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg5335 Product name: recombinant human CCL4L1 protein Source: mammalian cells -derived, pHZ-KIsec-N-rFc Tag: N-rFc Domain: 24-92 aa of N/A Sequence: APMGSDPPTACCFSYTARKLPRNFVVDYYETSSLCSQPAVVFQTKRGKQVCADPSESWVQEYVYDLELN Predict reactive species Full Name: chemokine (C-C motif) ligand 4-like 1 Calculated Molecular Weight: 10 kDa Observed Molecular Weight: 15 kDa GenBank Accession Number: N/A Gene Symbol: CCL4L1 Gene ID (NCBI): 9560 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q8NHW4-1 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.