Iright
BRAND / VENDOR: Proteintech

Proteintech, 87378-1-RR, LSP1 Recombinant monoclonal antibody

CATALOG NUMBER: 87378-1-RR
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 100ul The LSP1 (87378-1-RR) by Proteintech is a Recombinant antibody targeting LSP1 in WB, IF/ICC, ELISA applications with reactivity to human samples 87378-1-RR targets LSP1 in WB, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: Raji cells, HL-60 cells, U-937 cells, Daudi cells, HuT 78 cells Positive IF/ICC detected in: Daudi cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunofluorescence (IF)/ICC: IF/ICC : 1:250-1:1000 Background Information Lymphocyte-specific protein 1(LSP1), also known as leukocyte-specific protein 1, is an F-actin binding and cytoskeleton associated protein. The protein is expressed in lymphocytes, neutrophils, and macrophages. LSP1 is a substrate for mitogen-activated protein kinase (MAPK)-activated protein kinase 2 and protein kinase C. The implication of LSP1 in diverse biological processes, such as inflammation and malignancy, suggests the major regulatory role of LSP1 in signal transduction(PMID: 38254711). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg5464 Product name: Recombinant human LSP1 protein Source: mammalian cells -derived, V37 Tag: C-rFc Domain: 1-339 aa of NM_002339.2 Sequence: MAEASSDPGAEEREELLGPTAQWSVEDEEEAVHEQCQHERDRQLQAQDEEGGGHVPERPKQEMLLSLKPSEAPELDEDEGFGDWSQRPEQRQQHEGAQGALDSGEPPQCRSPEGEQEDRPGLHAYEKEDSDEVHLEELSLSKEGPGPEDTVQDNLGAAGAEEEQEEHQKCQQPRTPSPLVLEGTIEQSSPPLSPTTKLIDRTESLNRSIEKSNSVKKSQPDLPISKIDQWLEQYTQAIETAGRTPKLARQASIELPSMAVASTKSRWETGEVQAQSAAKTPSCKDIVAGDMSKKSLWEQKGGSKTSSTIKSTPSGKRYKFVATGHGKYEKVLVEGGPAP Predict reactive species Full Name: lymphocyte-specific protein 1 Calculated Molecular Weight: 37 kDa Observed Molecular Weight: 52 kDa GenBank Accession Number: NM_002339.2 Gene Symbol: LSP1 Gene ID (NCBI): 4046 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P33241-1 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924