Iright
BRAND / VENDOR: Proteintech

Proteintech, 87451-1-RR, FBXO7 Recombinant monoclonal antibody

CATALOG NUMBER: 87451-1-RR
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 100ul The FBXO7 (87451-1-RR) by Proteintech is a Recombinant antibody targeting FBXO7 in WB, ELISA applications with reactivity to human samples 87451-1-RR targets FBXO7 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HCT 116 cells, SH-SY5Y cells, HeLa cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Background Information FBXO7, also named as FBX7, is a substrate recognition component of a (SKP1-CUL1-F-box protein) E3 ubiquitin-protein ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of target proteins. FBXO7 recognizes BIRC2 and DLGAP5. It function in phosphorylation-dependent ubiquitination. The observed molecular weight is consistent with the findings reported in PMID: 26310625 and PMID: 33774278. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag1035 Product name: Recombinant human FBXO7 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 220-522 aa of BC008361 Sequence: KALSMPEKWKLSGVYKLQYMHPLCEGSSATLTCVPLGNLIVVNATLKINNEIRSVKRLQLLPESFICKEKLGENVANIYKDLQKLSRLFKDQLVYPLLAFTRQALNLPDVFGLVVLPLELKLRIFRLLDVRSVLSLSAVCRDLFTASNDPLLWRFLYLRDFRDNTVRVQDTDWKELYRKRHIQRKESPKGRFVMLLPSSTHTIPFYPNPLHPRPFPSSRLPPGIIGGEYDQRPTLPYVGDPISSLIPGPGETPSQFPPLRPRFDPVGPLPGPNPILPGRGGPNDRFPFRPSRGRPTDGRLSFM Predict reactive species Full Name: F-box protein 7 Calculated Molecular Weight: 59 kDa Observed Molecular Weight: 75 kDa GenBank Accession Number: BC008361 Gene Symbol: FBXO7 Gene ID (NCBI): 25793 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q9Y3I1 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924