Iright
BRAND / VENDOR: Proteintech

Proteintech, 87468-1-RR, ST6GAL1 Recombinant monoclonal antibody

CATALOG NUMBER: 87468-1-RR
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 100ul The ST6GAL1 (87468-1-RR) by Proteintech is a Recombinant antibody targeting ST6GAL1 in WB, ELISA applications with reactivity to mouse, rat samples 87468-1-RR targets ST6GAL1 in WB, ELISA applications and shows reactivity with mouse, rat samples. Tested Applications Positive WB detected in: 4T1 cells, mouse liver tissue, rat liver tissue Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Background Information ST6GAL1 is a sialyltransferase mediating the glycosylation of proteins and lipids to form functionally important glycoproteins and glycolipids in the Golgi compartment. It is principally expressed in liver, placenta, and skeletal muscle (PMID: 15049997, PMID: 23358684). Two molecular forms of ST6GAL1 are generally observed, a larger 49-50 kDa and a smaller 39-42 kDa form, representing its full-length and the smaller soluble catalytic domain, respectively (PMID: 35676533, PMID: 35661210). Specification Tested Reactivity: mouse, rat Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg5251 Product name: Recombinant mouse ST6GAL1 protein Source: mammalian cells -derived, V37 Tag: C-rFc Domain: 27-403 aa of NM_001252505.1 Sequence: KKGSDYEALTLQAKVFQMPKSQEKVAVGPAPQAVFSNSKQDPKEGVQILSYPRVTAKVKPQPSLQVWDKDSTYSKLNPRLLKIWRNYLNMNKYKVSYKGPGPGVKFSVEALRCHLRDHVNVSMIEATDFPFNTTEWEGYLPKENFRTKAGPWHKCAVVSSAGSLKNSQLGREIDNHDAVLRFNGAPTDNFQQDVGTKTTIRLVNSQLVTTEKRFLKDSLYTEGILILWDPSVYHADIPQWYQKPDYNFFETYKSYRRLHPSQPFYILKPQMPWELWDIIQEISPDLIQPNPPSSGMLGIIIMMTLCDQVDIYEFLPSKRKTDVCYYHQKFFDSACTMGAYHPLLFEKNMVKHLNEGTDEDIYLFGKATLSGFRNNRC Predict reactive species Full Name: beta galactoside alpha 2,6 sialyltransferase 1 Calculated Molecular Weight: 47 kDa Observed Molecular Weight: 39-42 kDa and 49-50 kDa GenBank Accession Number: NM_001252505.1 Gene Symbol: St6gal1 Gene ID (NCBI): 20440 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q64685 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924