Product Description
Size: 20ul / 100ul
The LY6K (87480-4-RR) by Proteintech is a Recombinant antibody targeting LY6K in WB, ELISA applications with reactivity to human samples
87480-4-RR targets LY6K in WB, ELISA applications and shows reactivity with human samples.
Tested Applications
Positive WB detected in: HeLa cells, human testis tissue, SiHa cells, 143B cells, DU 145 cells, A431 cells
Recommended dilution
Western Blot (WB): WB : 1:1000-1:6000
Background Information
The LY6K (Lymphocyte antigen 6K) protein belongs to the LY6/uPAR superfamily and is a class of small glycoproteins that are anchored to the outer side of the cell membrane via glycosylphosphatidylinositol (GPI).
Specification
Tested Reactivity: human
Host / Isotype: Rabbit / IgG
Class: Recombinant
Type: Antibody
Immunogen: CatNo: Eg5676 Product name: Recombinant human LY6K protein Source: mammalian cells -derived, V37 Tag: C-rFc Domain: 18-138 aa of NM_017527.3 Sequence: DANLTARQRDPEDSQRTDEGDNRVWCHVCERENTFECQNPRRCKWTEPYCVIAAVKIFPRFFMVAKQCSAGCAAMERPKPEEKRFLLEEPMPFFYLKCCKIRYCNLEGPPINSSVFKEYAG Predict reactive species
Full Name: lymphocyte antigen 6 complex, locus K
Calculated Molecular Weight: 19 kDa
Observed Molecular Weight: 18-26 kDa
GenBank Accession Number: NM_017527.3
Gene Symbol: LY6K
Gene ID (NCBI): 54742
Conjugate: Unconjugated
Form: Liquid
Purification Method: Protein A purification
UNIPROT ID: Q17RY6-1
Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.
Order Guidelines
1. Price & Stock Available on Request. Click to send email to: service@iright.com
2. Please DO NOT make payment before confirmation.
3. Minimum order value of $1,000 USD required.
Collaboration
Tony Tang
Email: Tony.Tang@iright.com
Mobile/WhatsApp/Wechat: +86-17717886924