Proteintech, 87506-1-RR, PDGF-BB Recombinant monoclonal antibody

Size: 20ul / 100ul The PDGF-BB (87506-1-RR) by Proteintech is a Recombinant antibody targeting PDGF-BB in WB, ELISA applications with reactivity to human, mouse, rat samples 87506-1-RR targets PDGF-BB in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse brain tissue, rat lung tissue, rat brain tissue Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg4856 Product name: recombinant mouse PDGF-BB protein Source: mammalian cells -derived, pHZ-KIsec-C-rFc Tag: C-rFc Domain: 82-190 aa of AAH23427.1 Sequence: SLGSLAAAEPAVIAECKTRTEVFQISRNLIDRTNANFLVWPPCVEVQRCSGCCNNRNVQCRASQVQMRPVQVRKIEIVRKKPIFKKATVTLEDHLACKCETIVTPRPVT Predict reactive species Full Name: platelet derived growth factor, B polypeptide Calculated Molecular Weight: 25kd Observed Molecular Weight: 30 kDa GenBank Accession Number: AAH23427.1 Gene Symbol: Pdgfb Gene ID (NCBI): 18591 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P31240 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.