Proteintech, 87507-1-RR, IL-6 Recombinant monoclonal antibody

Size: 20ul / 100ul The IL-6 (87507-1-RR) by Proteintech is a Recombinant antibody targeting IL-6 in WB, ELISA applications with reactivity to pig samples 87507-1-RR targets IL-6 in WB, ELISA applications and shows reactivity with pig samples. Tested Applications Positive WB detected in: Recombinant protein, Transfected with Pig IL-6 CHO cells Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Background Information Interleukin-6 (IL-6) is an interleukin that acts as both a pro-inflammatory and anti-inflammatory cytokine. IL-6 protein is secreted by a variety of cell types including T cells and macrophages as phosphorylated and variably glycosylated molecule. IL-6 plays an essential role in the final differentiation of B-cells into Ig-secreting cells involved in lymphocyte and monocyte differentiation. It induces myeloma and plasmacytoma growth and induces nerve cells differentiation Acts on B-cells, T-cells, hepatocytes, hematopoietic progenitor cells and cells of the CNS. IL-6 is also considered a myokine, a cytokine produced from muscle, and is elevated in response to muscle contraction. IL-6 has been shown to interact with interleukin-6 receptor and glycoprotein 130. Additionally, IL-6 is involved in hematopoiesis, bone metabolism, and cancer progression, and has been defined an essential role in directing transition from innate to acquired immunity Specification Tested Reactivity: pig Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg4865 Product name: Recombinant Pig IL-6 protein (rFc Tag) Source: mammalian cells -derived, pHZ-KIsec-N-rFc Tag: N-rFc Domain: 30-212 aa of / Sequence: ERLEEDAKGDATSDKMLFTSPDKTEELIKYILGKISAMRKEMCEKYEKCENSKEVLAENNLNLPKMAEKDGCFQSGFNQETCLMRITTGLVEFQIYLDYLQKEYESNKGNVEAVQISTKALIQTLRQKGKNPDKATTPNPTTNAGLLDKLQSQNEWMKNTKIILILRSLEDFLQFSLRAIRIM Predict reactive species Full Name: Interleukin-6 Calculated Molecular Weight: 24 kDa GenBank Accession Number: / Gene Symbol: IL-6 Gene ID (NCBI): 399500 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P26893 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.