Proteintech, 87517-1-RR, CKMT2 Recombinant monoclonal antibody

Size: 20ul / 100ul The CKMT2 (87517-1-RR) by Proteintech is a Recombinant antibody targeting CKMT2 in WB, ELISA applications with reactivity to human, mouse, rat samples 87517-1-RR targets CKMT2 in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: rat heart tissue, HEK-293T cells, mouse heart tissue, mouse skeletal muscle tissue, rat skeletal muscle tissue, human heart tissue Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Background Information CKMT2 (Creatine kinase S-type, mitochondrial), also known as s-MtCK, is one of the creatine kinase (CK) isozymes that are tightly coupled to adenosine triphosphate (ATP) output via adenine nucleotide transport proteins or carriers, making it an important player in ATP synthesis and respiratory chain activity (PMID: 38172162). Enhancing Ckmt2 expression or activity can protect against myocardial injury caused by ischemia-reperfusion injury (PMID: 39457679). Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag3971 Product name: Recombinant human CKMT2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 57-419 aa of BC029140 Sequence: LRKHNNCMAECLTPAIYAKLRNKVTPNGYTLDQCIQTGVDNPGHPFIKTVGMVAGDEESYEVFADLFDPVIKLRHNGYDPRVMKHTTDLDASKITQGQFDEHYVLSSRVRTGRSIRGLSLPPACTRAERREVENVAITALEGLKGDLAGRYYKLSEMTEQDQQRLIDDHFLFDKPVSPLLTCAGMARDWPDARGIWHNYDKTFLIWINEEDHTRVISMEKGGNMKRVFERFCRGLKEVERLIQERGWEFMWNERLGYILTCPSNLGTGLRAGVHVRIPKLSKDPRFSKILENLRLQKRGTGGVDTAAVADVYDISNIDRIGRSEVELVQIVIDGVNYLVDCEKKLERGQDIKVPPPLPQFGKK Predict reactive species Full Name: creatine kinase, mitochondrial 2 (sarcomeric) Calculated Molecular Weight: 419 aa, 48 kDa Observed Molecular Weight: 41-48 kDa GenBank Accession Number: BC029140 Gene Symbol: CKMT2 Gene ID (NCBI): 1160 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P17540 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.