Proteintech, 87528-1-RR, NRAC Recombinant monoclonal antibody

Size: 20ul / 100ul The NRAC (87528-1-RR) by Proteintech is a Recombinant antibody targeting NRAC in WB, ELISA applications with reactivity to human samples 87528-1-RR targets NRAC in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: human heart tissue Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Background Information NRAC (Nutritionally Regulated Adipose and Cardiac enriched protein, with the human homologous gene designated as C14ORF180) is a recently identified adipocyte-specific double-pass transmembrane protein. Both its N- and C-termini are located intracellularly, containing only a short extracellular loop and no known enzymatic domains. Its expression is significantly induced during the differentiation of white and brown adipocytes and is regulated by nutritional status: fasting and obesity both downregulate its mRNA levels, suggesting its role as a "fat sensor" in energy homeostasis. Mechanistically, NRAC forms a trimeric complex via its first transmembrane domain with the fatty acid transporter core protein CD36 and the membrane microdomain protein caveolin-1. When extracellular fatty acid concentrations increase, NRAC undergoes ubiquitination and internalization, causing CD36 to dissociate from caveolin-1 and switch to clathrin-mediated endocytosis. This process enhances fatty acid uptake, leading to adipocyte hypertrophy and increased overall adipose mass. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg6025 Product name: Recombinant human NRAC protein (C-rFc) Source: mammalian cells -derived, V37 Tag: C-rFc Domain: 1-100 aa of NM_001008404.2 Sequence: MRTAAGAVSPDSRPETRRQTRKNEEAAWGPRVCRAEREDNRKCPPSILKRSRPEHHRPEAKPQRTSRRVWFREPPAVTVHYIADKNATATVRVPGRPRPH Predict reactive species Full Name: chromosome 14 open reading frame 180 Calculated Molecular Weight: 18 kDa Observed Molecular Weight: 18 kDa GenBank Accession Number: NM_001008404.2 Gene Symbol: C14orf180 Gene ID (NCBI): 400258 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q8N912 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.