Proteintech, 87529-1-RR, NOP10 Recombinant monoclonal antibody

Size: 20ul / 100ul The NOP10 (87529-1-RR) by Proteintech is a Recombinant antibody targeting NOP10 in WB, ELISA applications with reactivity to human, mouse, rat samples 87529-1-RR targets NOP10 in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HeLa cells, Jurkat cells, Caco-2 cells, COLO 320 cells, mouse thymus tissue, rat thymus tissue Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Background Information Nucleolar protein 10 (NOP10) is a component of the H/ACA small nucleolar ribonucleoprotein (snoRNP) complex and is essential for maintaining telomerase activity and RNA pseudouridylation. NOP10 is abnormally expressed in a variety of cancers such as breast cancer, pancreatic cancer, lung cancer, etc., and high expression is usually associated with poor prognosis(PMID: 33161513; 39538226). Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag18718 Product name: Recombinant human NOP10 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-64 aa of BC063023 Sequence: MFLQYYLNEQGDRVYTLKKFDPMGQQTCSAHPARFSPDDKYSRHRITIKKRFKVLMTQQPRPVL Predict reactive species Full Name: NOP10 ribonucleoprotein homolog (yeast) Calculated Molecular Weight: 64 aa, 77 kDa Observed Molecular Weight: 10-12 kDa GenBank Accession Number: BC063023 Gene Symbol: NOP10 Gene ID (NCBI): 55505 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q9NPE3 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.