Proteintech, 87532-1-RR, CD3 Delta Recombinant monoclonal antibody

Size: 20ul / 100ul The CD3 Delta (87532-1-RR) by Proteintech is a Recombinant antibody targeting CD3 Delta in WB, ELISA applications with reactivity to mouse, rat samples 87532-1-RR targets CD3 Delta in WB, ELISA applications and shows reactivity with mouse, rat samples. Tested Applications Positive WB detected in: mouse thymus tissue, rat thymus tissue, mouse spleen tissue, rat spleen tissue Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Background Information CD3 is a complex of proteins that directly associates with the T cell receptor (TCR). The TCR/CD3 complex of T-lymphocytes consists of either a TCR alpha/beta or TCR gamma/delta heterodimer coexpressed at the cell surface with the invariant subunits of CD3 labeled gamma, delta, epsilon, zeta, and eta. The TCR recognizes antigens bound to major histocompatibility complex (MHC) molecules. TCR-mediated peptide-MHC recognition is transmitted to the CD3 complex, leading to the intracellular signal transduction. CD3 is considered to be a pan-T cell marker for detection of normal and neoplastic T cells. CD3 delta/CD3D is a single-pass type I membrane protein which consists of an extracellular domain of 84 amino acids, a transmembrane region, and a cytoplasmic domain of 45 amino acids. Defects in CD3 delta are a cause of severe combined immunodeficiency. Specification Tested Reactivity: mouse, rat Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg4665 Product name: recombinant mouse CD3D protein Source: mammalian cells -derived, V37 Tag: C-rFc Domain: 22-105 aa of NM_013487.3 Sequence: FKIQVTEYEDKVFVTCNTSVMHLDGTVEGWFAKNKTLNLGKGVLDPRGIYLCNGTEQLAKVVSSVQVHYRMCQNCVELDSGTMA Predict reactive species Full Name: CD3 antigen, delta polypeptide Calculated Molecular Weight: 19 kDa Observed Molecular Weight: 25 kDa GenBank Accession Number: NM_013487.3 Gene Symbol: Cd3d Gene ID (NCBI): 12500 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P04235 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.