Product Description
Size: 20ul / 100ul
The Rela (87545-1-RR) by Proteintech is a Recombinant antibody targeting Rela in WB, ELISA applications with reactivity to human, mouse, rat samples
87545-1-RR targets Rela in WB, ELISA applications and shows reactivity with human, mouse, rat samples.
Tested Applications
Positive WB detected in: A431 cells, NIH/3T3 cells, HSC-T6 cells, PC-12 cells, mouse testis tissue, rat testis tissue
Recommended dilution
Western Blot (WB): WB : 1:2000-1:10000
Background Information
Rela, also known as p65, is one of the most critical and extensively studied members of the nuclear factor κB (NF-κB) transcription factor family. As the core executor of the NF-κB signaling pathway, it typically forms the canonical p65-p50 heterodimer with the p50 subunit. In the resting state, Rela is anchored in the cytoplasm by the IκB inhibitory protein. Once the cell receives external stimuli such as inflammatory cytokines (TNF-α, IL-1), pathogen-associated molecular patterns (PAMPs), or stress signals, the IκB kinase (IKK) complex is activated, leading to the degradation of IκB and the release of Rela/p65. The activated Rela rapidly translocates to the nucleus, initiating the transcription of a large number of target genes that are widely involved in key biological processes such as acute inflammatory responses, cell survival, proliferation, and differentiation. Therefore, Rela serves as the core hub connecting upstream signals with downstream gene expression and plays a crucial role in immune responses, inflammatory diseases, and cancer.
Specification
Tested Reactivity: human, mouse, rat
Host / Isotype: Rabbit / IgG
Class: Recombinant
Type: Antibody
Immunogen: CatNo: Ag40017 Product name: Recombinant mouse Rela protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 425-549 aa of BC094053 Sequence: KSTQAGEGTLSEALLHLQFDADEDLGALLGNSTDPGVFTDLASVDNSEFQQLLNQGVSMSHSTAEPMLMEYPEAITRLVTGSQRPPDPAPTPLGTSGLPNGLSGDEDFSSIADMDFSALLSQISS* Predict reactive species
Full Name: v-rel reticuloendotheliosis viral oncogene homolog A (avian)
Observed Molecular Weight: 65 kDa
GenBank Accession Number: BC094053
Gene Symbol: Rela
Gene ID (NCBI): 19697
Conjugate: Unconjugated
Form: Liquid
Purification Method: Protein A purification
UNIPROT ID: Q04207
Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.
Order Guidelines
1. Price & Stock Available on Request. Click to send email to: service@iright.com
2. Please DO NOT make payment before confirmation.
3. Minimum order value of $1,000 USD required.
Collaboration
Tony Tang
Email: Tony.Tang@iright.com
Mobile/WhatsApp/Wechat: +86-17717886924