Proteintech, 87552-1-RR, MMP7 Recombinant monoclonal antibody

Size: 20ul / 100ul The MMP7 (87552-1-RR) by Proteintech is a Recombinant antibody targeting MMP7 in WB, ELISA applications with reactivity to human samples 87552-1-RR targets MMP7 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: A549 cells, SKOV-3 cells, HT-29 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:8000 Background Information Matrix metalloproteinase-7 (MMP-7)/ matrilysin is a member of the MMP family, but is structurally different from the other MMPs by virtue of the absence of a conserved COOH-terminal protein domain. MMPs are involved in the breakdown of extracellular matrix in normal physiological processes, such as embryonic development reproduction, and tissue remodeling, as well as in disease processes, such as arthritis and cancer metastasis. Most MMP's are secreted as inactive proproteins which are activated when cleaved by extracellular proteinases. MMP-7 degrades proteoglycans, fibronectin, elastin and casein, and is involved in wound healing, tumor progression, pulmonary fibrosis, and development of choroidal neovascularization in age-related macular degeneration. The expression of MMP-7 is increased in most tumors. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag0550 Product name: Recombinant human MMP7 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-100 aa of BC003635 Sequence: MRLTVLCAVCLLPGSLALPLPQEAGGMSELQWEQAQDYLKRFYLYDSETKNANSLEAKLKEMQKFFGLPITGMLNSHVIEIMQKPRCGVPDVAEYSLFPN Predict reactive species Full Name: matrix metallopeptidase 7 (matrilysin, uterine) Calculated Molecular Weight: 29 kDa Observed Molecular Weight: 27-30 kDa GenBank Accession Number: BC003635 Gene Symbol: MMP7 Gene ID (NCBI): 4316 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P09237 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.