Proteintech, 87553-2-RR, BEX4 Recombinant monoclonal antibody

Size: 20ul / 100ul The BEX4 (87553-2-RR) by Proteintech is a Recombinant antibody targeting BEX4 in WB, ELISA applications with reactivity to human samples 87553-2-RR targets BEX4 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HEK-293 cells, TT cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Background Information BEX4, also known as BEXL1 and NADE3, which belongs to the BEX family. The brain-expressed X-linked (BEX) family consists of five member genes (from 1 to 5) that are commonly located on the X chromosome. The molecular weight of BEXs is approximately 15 kDa, but little is known about their structural characteristics and molecular functions (PMID: 34576008). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag26207 Product name: Recombinant human BEX4 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-120 aa of BC015794 Sequence: MESKEELAANNLNGENAQQENEGGEQAPTQNEEESRHLGGGEGQKPGGNIRRGRVRRLVPNFRWAIPNRHIEHNEARDDVERFVGQMMEIKRKTREQQMRHYMRFQTPEPDNHYDFCLIP Predict reactive species Full Name: brain expressed, X-linked 4 Calculated Molecular Weight: 120 aa, 14 kDa Observed Molecular Weight: 18-20 kDa GenBank Accession Number: BC015794 Gene Symbol: BEX4 Gene ID (NCBI): 56271 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q9NWD9 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.