Proteintech, 87578-1-RR, TMEM150 Recombinant monoclonal antibody

Size: 20ul / 100ul The TMEM150 (87578-1-RR) by Proteintech is a Recombinant antibody targeting TMEM150 in WB, ELISA applications with reactivity to human, mouse, rat samples 87578-1-RR targets TMEM150 in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: Jurkat cells, Neuro-2a cells, PC-12 cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag36287 Product name: Recombinant human TMEM150 protein Source: e coli. -derived, PET30a Tag: 6*His Domain: 222-271 aa of BC050466 Sequence: YGTFSYEFGAVSSDTLVAALQPTPGRACKSSGSSSTSTHLNCAPESIAMI Predict reactive species Full Name: transmembrane protein 150 Calculated Molecular Weight: 271 aa, 29 kDa Observed Molecular Weight: 29 kDa GenBank Accession Number: BC050466 Gene Symbol: TMEM150 Gene ID (NCBI): 129303 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q86TG1 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.