Product Description
Size: 20ul / 100ul
The PELI1 (87624-2-RR) by Proteintech is a Recombinant antibody targeting PELI1 in WB, ELISA applications with reactivity to human, mouse, rat samples
87624-2-RR targets PELI1 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.
Tested Applications
Positive WB detected in: Ramos cells, PC-12 cells, mouse brain tissue, rat brain tissue
Recommended dilution
Western Blot (WB): WB : 1:500-1:2000
Background Information
PELI1 encodes pellino-1, an E3 ubiquitin-protein ligase pellino homolog. E3 ubiquitin ligase functions by catalyzing the covalent attachment of ubiquitin moieties onto substrate proteins. Pellino-1 is involved in the TLR and IL-1 signaling pathways via interaction with the complex containing IRAK kinases and TRAF6. Pellino-1 can mediate 'Lys-63'-linked polyubiquitination of IRAK1 allowing subsequent NF-kappa-B activation thus playing a role in cellular inflammation.
Specification
Tested Reactivity: human, mouse, rat
Host / Isotype: Rabbit / IgG
Class: Recombinant
Type: Antibody
Immunogen: CatNo: Ag2683 Product name: Recombinant human PELI1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 294-418 aa of BC011419 Sequence: MKRKDVVDEKQPWVYLNCGHVHGYHNWGNKEERDGKDRECPMCRSVGPYVPLWLGCEAGFYVDAGPPTHAFSPCGHVCSEKTTAYWSQIPLPHGTHTFHAACPFCAHQLAGEQGYIRLIFQGPLD Predict reactive species
Full Name: pellino homolog 1 (Drosophila)
Calculated Molecular Weight: 418 aa, 46 kDa
Observed Molecular Weight: 46-53 kDa
GenBank Accession Number: BC011419
Gene Symbol: PELI1
Gene ID (NCBI): 57162
Conjugate: Unconjugated
Form: Liquid
Purification Method: Protein A purification
UNIPROT ID: Q96FA3
Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.
Order Guidelines
1. Price & Stock Available on Request. Click to send email to: service@iright.com
2. Please DO NOT make payment before confirmation.
3. Minimum order value of $1,000 USD required.
Collaboration
Tony Tang
Email: Tony.Tang@iright.com
Mobile/WhatsApp/Wechat: +86-17717886924