Iright
BRAND / VENDOR: Proteintech

Proteintech, 87624-2-RR, PELI1 Recombinant monoclonal antibody

CATALOG NUMBER: 87624-2-RR
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 100ul The PELI1 (87624-2-RR) by Proteintech is a Recombinant antibody targeting PELI1 in WB, ELISA applications with reactivity to human, mouse, rat samples 87624-2-RR targets PELI1 in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: Ramos cells, PC-12 cells, mouse brain tissue, rat brain tissue Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Background Information PELI1 encodes pellino-1, an E3 ubiquitin-protein ligase pellino homolog. E3 ubiquitin ligase functions by catalyzing the covalent attachment of ubiquitin moieties onto substrate proteins. Pellino-1 is involved in the TLR and IL-1 signaling pathways via interaction with the complex containing IRAK kinases and TRAF6. Pellino-1 can mediate 'Lys-63'-linked polyubiquitination of IRAK1 allowing subsequent NF-kappa-B activation thus playing a role in cellular inflammation. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag2683 Product name: Recombinant human PELI1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 294-418 aa of BC011419 Sequence: MKRKDVVDEKQPWVYLNCGHVHGYHNWGNKEERDGKDRECPMCRSVGPYVPLWLGCEAGFYVDAGPPTHAFSPCGHVCSEKTTAYWSQIPLPHGTHTFHAACPFCAHQLAGEQGYIRLIFQGPLD Predict reactive species Full Name: pellino homolog 1 (Drosophila) Calculated Molecular Weight: 418 aa, 46 kDa Observed Molecular Weight: 46-53 kDa GenBank Accession Number: BC011419 Gene Symbol: PELI1 Gene ID (NCBI): 57162 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q96FA3 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924