Proteintech, 87669-1-RR, CXCL12/SDF-1 Recombinant monoclonal antibody

Size: 20ul / 100ul The CXCL12/SDF-1 (87669-1-RR) by Proteintech is a Recombinant antibody targeting CXCL12/SDF-1 in WB, ELISA applications with reactivity to mouse samples 87669-1-RR targets CXCL12/SDF-1 in WB, ELISA applications and shows reactivity with mouse samples. Tested Applications Positive WB detected in: Transfected with Mouse Cxcl12 HEK-293T cells Recommended dilution Western Blot (WB): WB : 1:1000-1:10000 Background Information In adulthood, CXCL12 plays an important role in angiogenesis by recruiting endothelial progenitor cells (EPCs) from the bone marrow through a CXCR4 dependent mechanism (PMID: 17878755). It is this function of CXCL12 that makes it a very important factor in carcinogenesis and the neovascularisation linked to tumour progression (PMID: 16943240). CXCL12 also has a role in tumor metastasis where cancer cells that express the receptor CXCR4 are attracted to metastasis target tissues that release the ligand, CXCL12 (PMID: 11242036 ). In breast cancer, however, increased expression of CXCL12 determines a reduced risk of distant metastasis (PMID: 19646861; 17724466 ). Specification Tested Reactivity: mouse Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg2402 Product name: recombinant mouse Cxcl12 protein Source: mammalian cells -derived, pHZ-KIsec-C-rFc Tag: C-rFc Domain: 22-89 aa of BC020297 Sequence: KPVSLSYRCPCRFFESHIARANVKHLKILNTPNCALQIVARLKNNNRQVCIDPKLKWIQEYLEKALNK Predict reactive species Full Name: chemokine (C-X-C motif) ligand 12 Calculated Molecular Weight: 11 kDa Observed Molecular Weight: 15 kDa GenBank Accession Number: BC020297 Gene Symbol: Cxcl12 Gene ID (NCBI): 20315 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P40224 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.