Proteintech, 98014-1-RR, Anti-Mouse GM-CSF Rabbit Recombinant Antibody

Size: 100ug The GM-CSF (98014-1-RR) by Proteintech is a Recombinant antibody targeting GM-CSF in FC (Intra) applications with reactivity to mouse samples 98014-1-RR targets GM-CSF in FC (Intra) applications and shows reactivity with mouse samples. Tested Applications Positive FC (Intra) detected in: PMA and ionomycin stimulated C57BL/6 CD3 T cells Recommended dilution Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in 100 μl suspension Background Information Gm-csf, also known as Csf2, is a monomeric glycoprotein secreted by macrophages, T cells, mast cells, NK cells, endothelial cells and fibroblasts that functions as a cytokine. Gm-csf was first characterized as a hematopoietic growth factor that stimulates the proliferation of myeloid cells from bone-marrow progenitors. Gm-csf is now recognized as an important activating and differentiation factor for immune cells, and is essential for a wide range of biological processes in both innate and adaptive immunity. Gm-csf has been shown to protect against pulmonary infection and intestinal inflammation, and it is necessary for normal pulmonary and colon homeostasis. Specification Tested Reactivity: mouse Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg0512 Product name: Recombinant Mouse GM-CSF protein (His Tag) Source: mammalian cells -derived, pHZ-KIsec-C-6*HIS Tag: N-6*HIS Domain: 18-141 aa of NM-009969 Sequence: APTRSPITVTRPWKHVEAIKEALNLLDDMPVTLNEEVEVVSNEFSFKKLTCVQTRLKIFEQGLRGNFTKLKGALNMTASYYQTYCPPTPETDCETQVTTYADFIDSLKTFLTDIPFECKKPGQK Predict reactive species Full Name: colony stimulating factor 2 (granulocyte-macrophage) GenBank Accession Number: NM-009969 Gene Symbol: GM-CSF Gene ID (NCBI): 12981 RRID: AB_3672157 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purfication UNIPROT ID: P01587 Storage Buffer: PBS with 0.09% sodium azide, pH 7.3. Storage Conditions: Store at 2-8°C. Stable for one year after shipment.