Proteintech, 98016-1-RR, Anti-Human TLR3/CD283 Rabbit Recombinant Antibody

Size: 100ug The TLR3/CD283 (98016-1-RR) by Proteintech is a Recombinant antibody targeting TLR3/CD283 in FC (Intra) applications with reactivity to human samples 98016-1-RR targets TLR3/CD283 in FC (Intra) applications and shows reactivity with human samples. Tested Applications Positive FC (Intra) detected in: human monocyte-derived immature dendritic cells Recommended dilution Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in 100 μl suspension Background Information TLR3 belongs to the Toll-like receptor family which is important in the innate immune response to pathogens. TLRs are highly conserved from Drosophila to humans and share structural and functional similarities. TLR3 is a nucleotide-sensing TLR that is activated by double-stranded RNA. Upon recognition of dsRNA, TLR3 transmits signals via the adaptor protein TICAM-1/TRIF, leading to the induction of type I IFN, cytokine/chemokine production, and dendritic cell (DC) maturation (PMID: 18262679). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag34044 Product name: Recombinant human TLR3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 725-904 aa of BC094737 Sequence: FEGWRISFYWNVSVHRVLGFKEIDRQTEQFEYAAYIIHAYKDKDWVWEHFSSMEKEDQSLKFCLEERDFEAGVFELEAIVNSIKRSRKIIFVITHHLLKDPLCKRFKVHHAVQQAIEQNLDSIILVFLEEIPDYKLNHALCLRRGMFKSHCILNWPVQKERIGAFRHKLQVALGSKNSVH Predict reactive species Full Name: toll-like receptor 3 Calculated Molecular Weight: 904 aa, 104 kDa GenBank Accession Number: BC094737 Gene Symbol: TLR3 Gene ID (NCBI): 7098 RRID: AB_3672159 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purfication UNIPROT ID: O15455 Storage Buffer: PBS with 0.09% sodium azide, pH 7.3. Storage Conditions: Store at 2-8°C. Stable for one year after shipment.