Proteintech, 98032-1-RR, Anti-Human CD28 Rabbit Recombinant Antibody

Size: 100ug The CD28 (98032-1-RR) by Proteintech is a Recombinant antibody targeting CD28 in FC applications with reactivity to human, monkey, non-human primates samples 98032-1-RR targets CD28 in FC applications and shows reactivity with human, monkey, non-human primates samples. Tested Applications Positive FC detected in: human PBMCs Recommended dilution Flow Cytometry (FC): FC : 0.25 ug per 10^6 cells in 100 μl suspension Background Information CD28 (T-cell-specific surface glycoprotein CD28), also known as T44 and Tp44, is a 44 kD disulfide-linked homodimeric type I glycoprotein (PMID: 2162180). It is a member of the immunoglobulin superfamily and is expressed on most T lineage cells, NK cell subsets, and plasma cells (PMID: 2162180, 8386518). CD28 may affect in vivo immune responses by functioning both as a cell adhesion molecule linking B and T lymphocytes and as the surface component of a novel signal transduction pathway (PMID: 2162180, 3021470). CD28 binds both CD80 and CD86 with a highly conserved motif MYPPY in the CDR3-like loop (PMID: 15696168, 7964482). CD28 is considered a major co-stimulatory molecule, inducing T lymphocyte activation and IL-2 synthesis, and preventing cell death (PMID: 1348520). Specification Tested Reactivity: human, monkey, non-human primates Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg0889 Product name: Recombinant Human CD28 protein (His Tag) Source: mammalian cells -derived, pHZ-KIsec-C-6*HIS Tag: C-6*HIS Domain: 19-152 aa of BC093698 Sequence: NKILVKQSPMLVAYDNAVNLSCKYSYNLFSREFRASLHKGLDSAVEVCVVYGNYSQQLQVYSKTGFNCDGKLGNESVTFYLQNLYVNQTDIYFCKIEVMYPPPYLDNEKSNGTIIHVKGKHLCPSPLFPGPSKP Predict reactive species Full Name: CD28 molecule Calculated Molecular Weight: 220 aa, 25 kDa GenBank Accession Number: BC093698 Gene Symbol: CD28 Gene ID (NCBI): 940 ENSEMBL Gene ID: ENSG00000178562 RRID: AB_3672177 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purfication UNIPROT ID: P10747 Storage Buffer: PBS with 0.09% sodium azide, pH 7.3. Storage Conditions: Store at 2-8°C. Stable for one year after shipment.