Proteintech, 98036-1-RR, Anti-Mouse IL-15 Rabbit Recombinant Antibody

Size: 100ug The IL-15 (98036-1-RR) by Proteintech is a Recombinant antibody targeting IL-15 in FC (Intra) applications with reactivity to mouse samples 98036-1-RR targets IL-15 in FC (Intra) applications and shows reactivity with mouse samples. Tested Applications Positive FC (Intra) detected in: Mouse PBMCs Recommended dilution Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in 100 μl suspension Background Information IL-15 is a 4-α-helix bundle cytokine playing a pivotal role in stimulation of both innate and adaptive immune cells. It is produced primarily by keratinocytes, skeletal muscle cells, monocytes, and CD4+ T cells. It is a member of the common gamma chain family. The members of the common gamma chain family include the IL-2, IL-4, IL-7, IL-9, and IL-21 and require binding to the common gamma chain receptor for activation. It can be used in growth and maintenance of T and NK cells. It is also shown to be used in proliferation and functional effect of T cells for adoptive cell therapy. It is a glycosylated protein and HumanKine IL-15 appear as 12.5-25 kDa bands (PMID: 24587813, 26627006, 27849617, 31250350) Specification Tested Reactivity: mouse Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg0359 Product name: recombinant mouse il15 protein Source: mammalian cells -derived, pHZ-KIsec-Cfc-2 Tag: C-FC Domain: 49-162 aa of NM_001254747 Sequence: NWIDVRYDLEKIESLIQSIHIDTTLYTDSDFHPSCKVTAMNCFLLELQVILHEYSNMTLNETVRNVLYLANSTLSSNKNVAESGCKECEELEEKTFTEFLQSFIRIVQMFINTS Predict reactive species Full Name: interleukin 15 Calculated Molecular Weight: 19 kDa GenBank Accession Number: NM_001254747 Gene Symbol: IL-15 Gene ID (NCBI): 16168 RRID: AB_3672182 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purfication UNIPROT ID: P48346 Storage Buffer: PBS with 0.09% sodium azide, pH 7.3. Storage Conditions: Store at 2-8°C. Stable for one year after shipment.