Iright
BRAND / VENDOR: Proteintech

Proteintech, 98041-1-RR, Anti-Mouse CD117/c-Kit Rabbit Recombinant Antibody

CATALOG NUMBER: 98041-1-RR
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 100ug The CD117/c-Kit (98041-1-RR) by Proteintech is a Recombinant antibody targeting CD117/c-Kit in FC applications with reactivity to mouse samples 98041-1-RR targets CD117/c-Kit in FC applications and shows reactivity with mouse samples. Tested Applications Positive FC detected in: mouse bone marrow cells Recommended dilution Flow Cytometry (FC): FC : 0.25 ug per 10^6 cells in a 100 µl suspension Background Information CD117, also known as c-Kit and SCFR, is a transmembrane protein with tyrosine kinase activity encoded by the oncogene c-kit (PMID: 2448137). It is a member of the type III receptor tyrosine kinase family, which also includes CSF-1R, PDGFRβ, PDGFRα, and FLT3 (PMID: 29518044). CD117 is expressed on hematopoietic stem cells and progenitor cells, mast cells, and is also found in a wide range of non-haemopoietic cell types (including melanocytes, germ cells, astrocytes, renal tubules, breast glandular epithelial cells, sweat glands, and interstitial cells of Cajal) (PMID: 10582338; 23073628). CD117 plays an important role in early haemopoiesis. It is also involved in pigmentation, fertility, gut movement, and some aspects of the nervous system (PMID: 23073628). Specification Tested Reactivity: mouse Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg0883 Product name: Recombinant Mouse CD117/c-kit protein (His Tag) Source: mammalian cells -derived, pHZ-KIsec-C-6*HIS Tag: C-6*HIS Domain: 25-527 aa of NM_001122733.1 Sequence: SQPSASPGEPSPPSIHPAQSELIVEAGDTLSLTCIDPDFVRWTFKTYFNEMVENKKNEWIQEKAEATRTGTYTCSNSNGLTSSIYVFVRDPAKLFLVGLPLFGKEDSDALVRCPLTDPQVSNYSLIECDGKSLPTDLTFVPNPKAGITIKNVKRAYHRLCVRCAAQRDGTWLHSDKFTLKVRAAIKAIPVVSVPETSHLLKKGDTFTVVCTIKDVSTSVNSMWLKMNPQPQHIAQVKHNSWHRGDFNYERQETLTISSARVDDSGVFMCYANNTFGSANVTTTLKVVEKGFINISPVKNTTVFVTDGENVDLVVEYEAYPKPEHQQWIYMNRTSANKGKDYVKSDNKSNIRYVNQLRLTRLKGTEGGTYTFLVSNSDASASVTFNVYVNTKPEILTYDRLINGMLQCVAEGFPEPTIDWYFCTGAEQRCTTPVSPVDVQVQNVSVSPFGKLVVQSSIDSSVFRHNGTVECKASNDVGKSSAFFNFAFKGNNKEQIQAHTLFTP Predict reactive species Full Name: kit oncogene Calculated Molecular Weight: 109 kDa GenBank Accession Number: NM_001122733.1 Gene Symbol: CD117 Gene ID (NCBI): 16590 RRID: AB_3672188 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purfication UNIPROT ID: P05532-1 Storage Buffer: PBS with 0.09% sodium azide, pH 7.3. Storage Conditions: Store at 2-8°C. Stable for one year after shipment.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924