Iright
BRAND / VENDOR: Proteintech

Proteintech, 98056-1-RR, Anti-Human TNF beta Rabbit Recombinant Antibody

CATALOG NUMBER: 98056-1-RR
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 100ug The TNF beta (98056-1-RR) by Proteintech is a Recombinant antibody targeting TNF beta in FC (Intra) applications with reactivity to human samples 98056-1-RR targets TNF beta in FC (Intra) applications and shows reactivity with human samples. Tested Applications Positive FC (Intra) detected in: Anti-CD3/CD28 treated human PBMCs Recommended dilution Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in 100 μl suspension Background Information TNF beta also known as lymphotoxin alpha (LTA), is a member of the tumor necrosis factor family, and is a cytokine produced by lymphocytes. TNF Beta is highly inducible, secreted, and forms heterotrimers with lymphotoxin-beta which anchor lymphotoxin-alpha to the cell surface. TNF Beta also mediates a large variety of inflammatory, immunostimulatory, and antiviral responses, is involved in the formation of secondary lymphoid organs during development and plays a role in apoptosis. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg0836 Product name: Recombinant Human TNF-beta protein (His Tag) Source: mammalian cells -derived, pHZ-KIsec-C-6*HIS Tag: C-6*HIS Domain: 35-205 aa of BC034729 Sequence: LPGVGLTPSAAQTARQHPKMHLAHSTLKPAAHLIGDPSKQNSLLWRANTDRAFLQDGFSLSNNSLLVPTSGIYFVYSQVVFSGKAYSPKATSSPLYLAHEVQLFSSQYPFHVPLLSSQKMVYPGLQEPWLHSMYHGAAFQLTQGDQLSTHTDGIPHLVLSPSTVFFGAFAL Predict reactive species Full Name: lymphotoxin alpha (TNF superfamily, member 1) Calculated Molecular Weight: 205 aa, 22 kDa GenBank Accession Number: BC034729 Gene Symbol: TNF beta Gene ID (NCBI): 4049 RRID: AB_3672203 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purfication UNIPROT ID: P01374 Storage Buffer: PBS with 0.09% sodium azide, pH 7.3. Storage Conditions: Store at 2-8°C. Stable for one year after shipment.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924