Iright
BRAND / VENDOR: Proteintech

Proteintech, 98070-1-RR, Anti-Human Granzyme B Rabbit Recombinant Antibody

CATALOG NUMBER: 98070-1-RR
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • ddddd

    99 xxxxxx

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 100ug The Granzyme B (98070-1-RR) by Proteintech is a Recombinant antibody targeting Granzyme B in FC (Intra) applications with reactivity to human samples 98070-1-RR targets Granzyme B in IHC, FC (Intra) applications and shows reactivity with human samples. Tested Applications Positive FC (Intra) detected in: human PBMCs Recommended dilution Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension Background Information GZMB (Granzyme B) is also named as CGL1, CSPB, CTLA1, GRB and belongs to the Granzyme subfamily. This enzyme is necessary for target cell lysis in cell-mediated immune responses. The cytotoxic lymphocyte protease granzyme B (GzmB) can promote apoptosis through direct processing and activation of members of the caspase family. GzmB can also cleave the BH3-only protein, BID, to promote caspase-independent mitochondrial permeabilization (PMID:17283187). GzmB induces lamin B degradation in isolated nuclei less efficiently than GzmA (PMID:11331782). This full-length protein has 2 glycosylation sites and a signal peptide. Unglycosylated human granzyme B is 26 kDa and high mannose glycosylated is 32 kDa and only 32 kDa or smaller forms of granzyme B are accumulated within nuclei (PMID:8626751). GzmB also forms dimers. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg0592 Product name: Recombinant Human Granzyme B protein (His Tag) Source: mammalian cells -derived, pHZ-KIsec-C-6*HIS Tag: C-10*HIS Domain: 19-247 aa of BC030195 Sequence: GEIIGGHEAKPHSRPYMAYLMIWDQKSLKRCGGFLIRDDFVLTAAHCWGSSINVTLGAHNIKEQEPTQQFIPVKRPIPHPAYNPKNFSNDIMLLQLERKAKRTRAVQPLRLPSNKAQVKPGQTCSVAGWGQTAPLGKHSHTLQEVKMTVQEDRKCESDLRHYYDSTIELCVGDPEIKKTSFKGDSGGPLVCNKVAQGIVSYGRNNGMPPRACTKVSSFVHWIKKTMKRY Predict reactive species Full Name: granzyme B (granzyme 2, cytotoxic T-lymphocyte-associated serine esterase 1) Calculated Molecular Weight: 247 aa, 28 kDa GenBank Accession Number: BC030195 Gene Symbol: Granzyme B Gene ID (NCBI): 3002 RRID: AB_3672217 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purfication UNIPROT ID: P10144 Storage Buffer: PBS with 0.09% sodium azide, pH 7.3. Storage Conditions: Store at 2 - 8°C. Stable for one year after shipment.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924