Proteintech, 98076-1-RR, Anti-Mouse CD84 Rabbit Recombinant Antibody

Size: 100ug The CD84 (98076-1-RR) by Proteintech is a Recombinant antibody targeting CD84 in FC applications with reactivity to mouse samples 98076-1-RR targets CD84 in FC applications and shows reactivity with mouse samples. Tested Applications Positive FC detected in: mouse splenocytes Recommended dilution Flow Cytometry (FC): FC : 0.25 ug per 10^6 cells in a 100 µl suspension Background Information CD84, also known as SLAMF5, is a member of the CD2 subfamily of the immunoglobulin receptor superfamily (PMID: 9310491). CD84 is a single-chain type-I glycoprotein composed of two extracellular Ig-like domains, a hydrophobic transmembrane region, and a cytoplasmic domain. It is broadly expressed on almost all leukocyte subsets. CD84 functions as a homophilic adhesion molecule, whose signaling can activate or inhibit leukocyte function depending on the cell type and its stage of activation or differentiation (PMID: 30522694). Specification Tested Reactivity: mouse Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg1313 Product name: Recombinant Mouse CD84/SLAMF5 protein (His Tag) Source: mammalian cells -derived, pHZ-KIsec-C-6*HIS Tag: C-6*HIS Domain: 22-221 aa of Sequence: KDADPMVMNGILGESVTFLLNIQEPKKIDNIAWTSQSSVAFIKPGVNKAEVTITQGTYKGRIEIIDQKYDLVIRDLRMEDAGTYKADINEENEETITKIYYLHIYRRLKTPKITQSLISSLNNTCNITLTCSVEKEEKDVTYSWSPFGEKSNVLQIVHSPMDQKLTYTCTAQNPVSNSSDSVTVQQPCTDTPSFHPRHAV Predict reactive species Full Name: CD84 antigen Calculated Molecular Weight: 37 kDa Gene Symbol: Cd84 Gene ID (NCBI): 12523 RRID: AB_3672223 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purfication UNIPROT ID: Q18PI6-1 Storage Buffer: PBS with 0.09% sodium azide, pH 7.3. Storage Conditions: Store at 2 - 8°C. Stable for one year after shipment.