Iright
BRAND / VENDOR: Proteintech

Proteintech, 98142-1-RR, Anti-Human IL-1 beta Rabbit Recombinant Antibody

CATALOG NUMBER: 98142-1-RR
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 100ug The IL-1 beta (98142-1-RR) by Proteintech is a Recombinant antibody targeting IL-1 beta in FC (Intra) applications with reactivity to human samples 98142-1-RR targets IL-1 beta in FC (Intra) applications and shows reactivity with human samples. Tested Applications Positive FC (Intra) detected in: IFN gamma, LPS and Brefeldin A treated human PBMCs Recommended dilution Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in 100 μl suspension Background Information Interleukin-1 is a pro-inflammatory cytokine with multiple biological effects. The IL-1 gene family encodes three proteins: IL-1α, IL-1β and their naturally occurring inhibitor Il-1RN. IL-1 Beta(IL-1β), mainly produced by blood monocytes and tissue macrophages, has been implicated in mediating both acute and chronic inflammation. IL-1β is known to be involved in a variety of cellular activities, including cell proliferation, differentiation and apoptosis. IL-1β is emerging as a key mediator of carcinogenesis that characterizes host-environment interactions. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg0286 Product name: Recombinant Human IL-1 Beta protein (His Tag) Source: mammalian cells -derived, pHZ-KIsec-C-6*HIS Tag: N-6*HIS Domain: 117-269 aa of BC008678 Sequence: APVRSLNCTLRDSQQKSLVMSGPYELKALHLQGQDMEQQVVFSMSFVQGEESNDKIPVALGLKEKNLYLSCVLKDDKPTLQLESVDPKNYPKKKMEKRFVFNKIEINNKLEFESAQFPNWYISTSQAENMPVFLGGTKGGQDITDFTMQFVSS Predict reactive species Full Name: interleukin 1, beta Calculated Molecular Weight: 269 aa, 31 kDa GenBank Accession Number: BC008678 Gene Symbol: IL1B Gene ID (NCBI): 3553 ENSEMBL Gene ID: ENSG00000125538 RRID: AB_3672288 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purfication UNIPROT ID: P01584 Storage Buffer: PBS with 0.09% sodium azide, pH 7.3. Storage Conditions: Store at 2 - 8°C. Stable for one year after shipment.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924