Proteintech, 98159-1-RR, Anti-Human IL-13 Rabbit Recombinant Antibody

Size: 100ug The IL-13 (98159-1-RR) by Proteintech is a Recombinant antibody targeting IL-13 in FC (Intra) applications with reactivity to human samples 98159-1-RR targets IL-13 in FC (Intra) applications and shows reactivity with human samples. Tested Applications Positive FC (Intra) detected in: PMA, Ionomycin and Brefeldin A treated human PBMCs Recommended dilution Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in 100 μl suspension Background Information Interleukin 13 (IL-13) is an immunoregulatory cytokine produced primarily by activated Th2 cells. This cytokine is involved in several stages of B-cell maturation and differentiation. IL-13 up-regulates CD23 and MHC class II expression, and promotes IgE isotype switching of B cells. IL-13 inhibits the production of a series of cytokines like IL-1, IL-6, TNF-alpha, and IL-8 by activated human monocytes. IL-13 induces IFN-gamma production by NK cells. IL-13 is thought to be important cytokine in the pathogenesis of asthma, and more recently has been shown to play a pivotal role in a number of fibrotic diseases including hepatic and pulmonary fibrosis, and nodular sclerosing Hodgkin's disease. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg0061 Product name: Recombinant Human IL-13 protein (Myc Tag, His Tag) Source: mammalian cells -derived, pHZ-KIsec Tag: Myc & 6*His Domain: 21-132 aa of AAK53823 Sequence: GPVPPSTALRELIEELVNITQNQKAPLCNGSMVWSINLTAGMYCAALESLINVSGCSAIEKTQRMLSGFCPHKVSAGQFSSLHVRDTKIEVAQFVKDLLLHLKKLFREGRFN Predict reactive species Full Name: interleukin 13 GenBank Accession Number: AAK53823 Gene Symbol: IL-13 Gene ID (NCBI): 3596 RRID: AB_3672302 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purfication UNIPROT ID: P35225 Storage Buffer: PBS with 0.09% sodium azide, pH 7.3. Storage Conditions: Store at 2 - 8°C. Stable for one year after shipment.