Proteintech, 98182-1-RR, Anti-Mouse TNFRSF9/CD137 Rabbit Recombinant Antibody

Size: 100ug The TNFRSF9/CD137 (98182-1-RR) by Proteintech is a Recombinant antibody targeting TNFRSF9/CD137 in FC applications with reactivity to mouse samples 98182-1-RR targets TNFRSF9/CD137 in FC applications and shows reactivity with mouse samples. Tested Applications Positive FC detected in: Con A treated mouse splenocytes Recommended dilution Flow Cytometry (FC): FC : 0.25 ug per 10^6 cells in 100 μl suspension Background Information CD137, also known as TNFRSF9 or 4-1BB, is an inducible T cell surface receptor that belongs to the tumor necrosis factor receptor superfamily. CD137 is a transmembrane protein expressed on the surface of activated T-cells. In addition, activation-dependent expression of CD137 has also been found in B lymphocytes, monocytes, and diverse nonlymphoid cell types. CD137 provides a co-stimulatory signal that enhances the survival, and differentiation of cells, and has a crucial role in the development of CD8 cytotoxic T cells and anti-tumor immunity. (PMID: 9826581; 23696891) Specification Tested Reactivity: mouse Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg1627 Product name: Recombinant Mouse TNFRSF9/CD137 protein (rFc Tag) Source: mammalian cells -derived, pHZ-KIsec-C-rFc Tag: C-rFc Domain: 24-187 aa of NM_001077509.1 Sequence: VQNSCDNCQPGTFCRKYNPVCKSCPPSTFSSIGGQPNCNICRVCAGYFRFKKFCSSTHNAECECIEGFHCLGPQCTRCEKDCRPGQELTKQGCKTCSLGTFNDQNGTGVCRPWTNCSLDGRSVLKTGTTEKDVVCGPPVVSFSPSTTISVTPEGGPGGHSLQVL Predict reactive species Full Name: tumor necrosis factor receptor superfamily, member 9 Calculated Molecular Weight: 28 kDa GenBank Accession Number: NM_001077509.1 Gene Symbol: Tnfrsf9 Gene ID (NCBI): 21942 RRID: AB_3672323 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purfication UNIPROT ID: P20334 Storage Buffer: PBS with 0.09% sodium azide, pH 7.3. Storage Conditions: Store at 2 - 8°C. Stable for one year after shipment.