Proteintech, 98204-1-RR, Anti-Human CD7 Rabbit Recombinant Antibody

Size: 100ug The CD7 (98204-1-RR) by Proteintech is a Recombinant antibody targeting CD7 in FC applications with reactivity to human samples 98204-1-RR targets CD7 in FC applications and shows reactivity with human samples. Tested Applications Positive FC detected in: human PBMCs Recommended dilution Flow Cytometry (FC): FC : 0.25 ug per 10^6 cells in 100 μl suspension Background Information CD7, also known as Leu-9 or GP40, is a 40-kDa single-pass type I transmembrane glycoprotein belonging to the immunoglobulin superfamily. CD7 is expressed on thymocytes, T cells, NK cells, and cells in the early stages of T, B, and myeloid cell differentiation (PMID: 10530432). It is one of the earliest antigens to appear on cells of the T-lymphocyte lineage (PMID: 3501369). CD7 plays a significant role in T-cell and T-cell/B-cell interactions during early lymphoid development. It is involved in the regulation of cell signaling and biology, including T-cell activation, proliferation, and the expression of interleukin-2 receptor alpha (IL-2Rα) (PMID: 11485208). CD7 is not only a marker for T-cells but also has functional implications in immune cell interactions and adhesion. It can provide co-stimulatory signals and is associated with CD3 and CD45, participating in T-cell activation (PMID: 7523512). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg3034 Product name: Recombinant Human CD7 protein (rFc Tag)(HPLC verified) Source: mammalian cells -derived, V37 Tag: C-rFc Domain: 26-180 aa of NM_006137.7 Sequence: AQEVQQSPHCTTVPVGASVNITCSTSGGLRGIYLRQLGPQPQDIIYYEDGVVPTTDRRFRGRIDFSGSQDNLTITMHRLQLSDTGTYTCQAITEVNVYGSGTLVLVTEEQSQGWHRCSDAPPRASALPAPPTGSALPDPQTASALPDPPAASALP Predict reactive species Full Name: CD7 molecule Calculated Molecular Weight: 25 kDa GenBank Accession Number: NM_006137.7 Gene Symbol: CD7 Gene ID (NCBI): 924 ENSEMBL Gene ID: ENSG00000173762 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purfication UNIPROT ID: P09564 Storage Buffer: PBS with 0.09% sodium azide, pH 7.3. Storage Conditions: Store at 2 - 8°C. Stable for one year after shipment.