Iright
BRAND / VENDOR: Proteintech

Proteintech, 98207-1-RR, Anti-Mouse PDGFR beta/CD140b Rabbit Recombinant Antibody

CATALOG NUMBER: 98207-1-RR
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 100ug The PDGFR beta/CD140b (98207-1-RR) by Proteintech is a Recombinant antibody targeting PDGFR beta/CD140b in FC applications with reactivity to mouse samples 98207-1-RR targets PDGFR beta/CD140b in FC applications and shows reactivity with mouse samples. Tested Applications Positive FC detected in: NIH/3T3 cells Recommended dilution Flow Cytometry (FC): FC : 0.25 ug per 10^6 cells in 100 μl suspension Background Information The Platelet-Derived Growth Factor Receptor Beta (PDGFR beta, also known as CD140b) is a receptor tyrosine kinase that plays a crucial role in various cellular processes, including cell proliferation, migration, and survival. In mice, PDGFR beta is particularly significant due to its expression in pericytes, which are cells that reside on the walls of capillaries and play a vital role in maintaining vascular stability and integrity (PMID: 20738866). In the central nervous system (CNS) of mice, PDGFR beta is predominantly expressed in pericytes and vascular smooth muscle cells. It is involved in the formation and maintenance of the blood-brain barrier, as well as in the regulation of angiogenesis and vascular stability. Research in mouse models has shown that PDGFR beta signaling is crucial for tissue repair and functional recovery after stroke. Mice with disrupted PDGFR beta signaling exhibit delayed recovery and increased infarction volume following cerebral ischemia (PMID: 21952111). Specification Tested Reactivity: mouse Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg1533 Product name: Recombinant Mouse PDGFR beta protein (rFc Tag) Source: mammalian cells -derived, pHZ-KIsec-C-rFc Tag: C-rFc Domain: 32-531 aa of NM_008809.2 Sequence: LVITPPGPEFVLNISSTFVLTCSGSAPVMWEQMSQVPWQEAAMNQDGTFSSVLTLTNVTGGDTGEYFCVYNNSLGPELSERKRIYIFVPDPTMGFLPMDSEDLFIFVTDVTETTIPCRVTDPQLEVTLHEKKVDIPLHVPYDHQRGFTGTFEDKTYICKTTIGDREVDSDTYYVYSLQVSSINVSVNAVQTVVRQGESITIRCIVMGNDVVNFQWTYPRMKSGRLVEPVTDYLFGVPSRIGSILHIPTAELSDSGTYTCNVSVSVNDHGDEKAINISVIENGYVRLLETLGDVEIAELHRSRTLRVVFEAYPMPSVLWLKDNRTLGDSGAGELVLSTRNMSETRYVSELILVRVKVSEAGYYTMRAFHEDDEVQLSFKLQVNVPVRVLELSESHPANGEQTIRCRGRGMPQPNVTWSTCRDLKRCPRKLSPTPLGNSSKEESQLETNVTFWEEDQEYEVVSTLRLRHVDQPLSVRCMLQNSMGGDSQEVTVVPHSLPFKV Predict reactive species Full Name: platelet derived growth factor receptor, beta polypeptide Calculated Molecular Weight: 123kDa GenBank Accession Number: NM_008809.2 Gene Symbol: PDGFR beta Gene ID (NCBI): 18596 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purfication UNIPROT ID: P05622-1 Storage Buffer: PBS with 0.09% sodium azide, pH 7.3. Storage Conditions: Store at 2 - 8°C. Stable for one year after shipment.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924