Proteintech, 98225-1-RR, Anti-Mouse SIRP Alpha/CD172a Rabbit Recombinant Antibody

Size: 100ug The SIRP Alpha/CD172a (98225-1-RR) by Proteintech is a Recombinant antibody targeting SIRP Alpha/CD172a in FC applications with reactivity to mouse samples 98225-1-RR targets SIRP Alpha/CD172a in FC applications and shows reactivity with mouse samples. Tested Applications Positive FC detected in: mouse bone marrow cells Recommended dilution Flow Cytometry (FC): FC : 0.25 ug per 10^6 cells in 100 μl suspension Background Information SIRP Alpha, also known as CD172a, SHPS-1, and BIT, belongs to the SIRP family. SIRP Alpha is a transmembrane glycoprotein expressed explicitly on myeloid cells and provides a "do not eat me" signal after engaging with integrin-associated protein CD47 on tumor cells (PMID: 36419386). SIRP Alpha shows heterogeneity in molecular weight (~65-120 kDa) in various tissues due to differential glycosylation (PMID: 18051954). Specification Tested Reactivity: mouse Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg1520 Product name: Recombinant Mouse SIRP alpha/CD172a protein (rFc Tag) Source: mammalian cells -derived, pHZ-KIsec-C-rFc Tag: C-rFc Domain: 32-373 aa of NM_007547.4 Sequence: KELKVTQPEKSVSVAAGDSTVLNCTLTSLLPVGPIRWYRGVGPSRLLIYSFAGEYVPRIRNVSDTTKRNNMDFSIRISNVTPADAGIYYCVKFQKGSSEPDTEIQSGGGTEVYVLAKPSPPEVSGPADRGIPDQKVNFTCKSHGFSPRNITLKWFKDGQELHPLETTVNPSGKNVSYNISSTVRVVLNSMDVNSKVICEVAHITLDRSPLRGIANLSNFIRVSPTVKVTQQSPTSMNQVNLTCRAERFYPEDLQLIWLENGNVSRNDTPKNLTKNTDGTYNYTSLFLVNSSAHREDVVFTCQVKHDQQPAITRNHTVLGFAHSSDQGSMQTFPDNNATHNWN Predict reactive species Full Name: signal-regulatory protein alpha Calculated Molecular Weight: 56 kDa GenBank Accession Number: NM_007547.4 Gene Symbol: Sirpa Gene ID (NCBI): 19261 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purfication UNIPROT ID: P97797-2 Storage Buffer: PBS with 0.09% sodium azide, pH 7.3. Storage Conditions: Store at 2 - 8°C. Stable for one year after shipment.