Proteintech, 98226-1-RR, Anti-Human C5AR1/CD88 Rabbit Recombinant Antibody

Size: 100ug The C5AR1/CD88 (98226-1-RR) by Proteintech is a Recombinant antibody targeting C5AR1/CD88 in FC applications with reactivity to human samples 98226-1-RR targets C5AR1/CD88 in FC applications and shows reactivity with human samples. Tested Applications Positive FC detected in: human peripheral blood leukocytes Recommended dilution Flow Cytometry (FC): FC : 0.25 ug per 10^6 cells in 100 μl suspension Background Information C5aR, also named CD88, is a G protein-coupled receptor for the anaphylatoxin C5a, a cleavage product of the complement cascade. The C5a ligand is a proinflammatory component of host defense. C5aR is activated upon binding of the C5a molecule. Receptor activation stimulates chemotaxis, granule enzyme release, intracellular calcium release, and superoxide anion production. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg2185 Product name: Recombinant Human C5AR1/CD88 protein (rFc Tag) Source: mammalian cells -derived, pHZ-KIsec-C-rFc Tag: C-rFc Domain: 1-37 aa of NM_001736.4 Sequence: MDSFNYTTPDYGHYDDKDTLDLNTPVDKTSNTLRVPD Predict reactive species Full Name: complement component 5a receptor 1 Calculated Molecular Weight: 39kDa GenBank Accession Number: NM_001736.4 Gene Symbol: C5aR Gene ID (NCBI): 728 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purfication UNIPROT ID: P21730 Storage Buffer: PBS with 0.09% sodium azide, pH 7.3. Storage Conditions: Store at 2 - 8°C. Stable for one year after shipment.