Proteintech, 98245-1-RR, Anti-Human CLEC10A/CD301 Rabbit Recombinant Antibody

Size: 100ug The CLEC10A/CD301 (98245-1-RR) by Proteintech is a Recombinant antibody targeting CLEC10A/CD301 in FC applications with reactivity to human samples 98245-1-RR targets CLEC10A/CD301 in FC applications and shows reactivity with human samples. Tested Applications Positive FC detected in: human immature monocyte-derived dendritic cells Recommended dilution Flow Cytometry (FC): FC : 0.25 ug per 10^6 cells in a 100 µl suspension Background Information C-type lectin domain family 10 member A (CLEC10A), also known as CD301, macrophage galactose-type C-type lectin (MGL), DC-asialoglyco protein receptor (DC-ASGP-R) or human macrophage lectin (HML), is a type II transmembrane glycoprotein having a calcium-dependent carbohydrate recognition domain (PMID: 8598452; 11919201; 11698450). CLEC10A is expressed exclusively by myeloid professional antigen-presenting cells such as immature dendritic cells (DCs) and alternatively activated macrophages (PMID: 16998493). CLEC10A is a marker for human CD1c+ DCs (cDC2) (PMID: 29755453). It functions as an endocytic receptor for glycosylated antigens (PMID: 11919201). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg1892 Product name: Recombinant Human CLEC10A/CD301 protein (rFc Tag) Source: mammalian cells -derived, pHZ-KIsec-N-rFc Tag: N-rFc Domain: 61-316 aa of BC039011 Sequence: QNSKFQRDLVTLRTDFSNFTSNTVAEIQALTSQGSSLEETIASLKAEVEGFKQERQAGVSELQEHTTQKAHLGHCPHCPSVCVPVHSEMLLRVQQLVQDLKKLTCQVATLNNNASTEGTCCPVNWVEHQDSCYWFSHSGMSWAEAEKYCQLKNAHLVVINSREEQNFVQKYLGSAYTWMGLSDPEGAWKWVDGTDYATGFQNWKPGQPDDWQGHGLGGGEDCAHFHPDGRWNDDVCQRPYHWVCEAGLGQTSQESH Predict reactive species Full Name: C-type lectin domain family 10, member A Calculated Molecular Weight: 316 aa, 35 kDa GenBank Accession Number: BC039011 Gene Symbol: CLEC10A Gene ID (NCBI): 10462 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purfication UNIPROT ID: Q8IUN9 Storage Buffer: PBS with 0.09% sodium azide, pH 7.3. Storage Conditions: Store at 2 - 8°C. Stable for one year after shipment.