Proteintech, 98269-1-RR, Anti-Mouse Glycophorin A/CD235a Rabbit Recombinant Antibody

Size: 100ug The Glycophorin A/CD235a (98269-1-RR) by Proteintech is a Recombinant antibody targeting Glycophorin A/CD235a in FC applications with reactivity to mouse samples 98269-1-RR targets Glycophorin A/CD235a in FC applications and shows reactivity with mouse samples. Tested Applications Positive FC detected in: mouse bone marrow cells Recommended dilution Flow Cytometry (FC): FC : 0.25 ug per 10^6 cells in 100 μl suspension Background Information Glycophorin A (GYPA), also known as CD235a, is the major transmembrane sialoglycoprotein in erythrocytes. It is a dimeric type I transmembrane protein carrying 15 closely clustered O-linked tetrasaccharides capped with sialic acid/N-acetylneuraminic acid (Neu5Ac). This 36 kDa protein represents the major sialoglycoprotein of the red blood cell membrane displaying about one million copies per cell. (PMID: 9490702) Specification Tested Reactivity: mouse Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg1886 Product name: Recombinant Mouse Glycophorin A protein (His Tag) Source: mammalian cells -derived, pHZ-KIsec-C-6*HIS Tag: C-6*HIS Domain: 1-108 aa of NM_010369.3 Sequence: MTESTAAVTTSGHSLTTTFHIPSSQHYQEEHSPSLSGSDSLLQITTPVVASTVGNPNQHSATMSTPAIHVSTYHTAPTEVSAAFEEQPVSPHIGGMPSPIQHDFPALV Predict reactive species Full Name: glycophorin A Calculated Molecular Weight: 18kDa GenBank Accession Number: NM_010369.3 Gene Symbol: Gypa Gene ID (NCBI): 14934 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purfication UNIPROT ID: P14220 Storage Buffer: PBS with 0.09% sodium azide, pH 7.3. Storage Conditions: Store at 2 - 8°C. Stable for one year after shipment.