Proteintech, 98270-1-RR, Anti-Mouse CD9 Rabbit Recombinant Antibody

Size: 100ug The CD9 (98270-1-RR) by Proteintech is a Recombinant antibody targeting CD9 in FC applications with reactivity to mouse samples 98270-1-RR targets CD9 in FC applications and shows reactivity with mouse samples. Tested Applications Positive FC detected in: mouse bone marrow cells Recommended dilution Flow Cytometry (FC): FC : 0.25 ug per 10^6 cells in 100 μl suspension Background Information The cell-surface molecule CD9, a member of the transmembrane-4 superfamily, interacts with the integrin family and other membrane proteins, and is postulated to participate in cell migration and adhesion. Expression of CD9 enhances membrane fusion between muscle cells and promotes viral infection in some cells (PMID:10459022). It is often used as a mesenchymal stem cell marker (PMID:18005405). Specification Tested Reactivity: mouse Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg1397 Product name: Recombinant Mouse CD9 protein (rFc Tag) Source: mammalian cells -derived, pHZ-KIsec-C-rFc Tag: C-rFc Domain: 110-193 aa of NM_007657.3 Sequence: THKDEVIKELQEFYKDTYQKLRSKDEPQRETLKAIHMALDCCGIAGPLEQFISDTCPKKQLLESFQVKPCPEAISEVFNNKFHI Predict reactive species Full Name: CD9 antigen Calculated Molecular Weight: 25 kDa GenBank Accession Number: NM_007657.3 Gene Symbol: Cd9 Gene ID (NCBI): 12527 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purfication UNIPROT ID: P40240 Storage Buffer: PBS with 0.09% sodium azide, pH 7.3. Storage Conditions: Store at 2 - 8°C. Stable for one year after shipment.