Iright
BRAND / VENDOR: Proteintech

Proteintech, 98305-2-RR, Anti-Human BST2 Rabbit Recombinant Antibody

CATALOG NUMBER: 98305-2-RR
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 100ug The BST2 (98305-2-RR) by Proteintech is a Recombinant antibody targeting BST2 in FC applications with reactivity to human samples 98305-2-RR targets BST2 in FC applications and shows reactivity with human samples. Tested Applications Positive FC detected in: human PBMCs Recommended dilution Flow Cytometry (FC): FC : 0.25 ug per 10^6 cells in a 100 µl suspension Background Information BST2, also named as CD317 and Tetherin, belongs to the tetherin family. It may be involved in the sorting of secreted proteins and it is involved in pre-B-cell growth. BST2 is an antiretroviral defense protein, that blocks release of retrovirus from the cell surface. Depleted unpon HIV-1 infection by viral VPU protein through 20S proteasome degradation. Depleted upon infection by human Kaposi's sarcoma-associated herpesvirus (KSHV) through ubiquitination and subsequent degradation. BST2 may play a role in B-cell activation in rheumatoid arthritis. It is recently identified interferon-induced cellular proteins that restrict infections by retroviruses and filoviruses and of influenza virus and flaviviruses, respectively. BST2 is a plasma membrane proteins, tetherin inhibits virion particle release from infected cells. BST2 is effective against retroviruses and flavoviruses whilst IFITMs disrupt influenza and flavivirus infection. Observed MW of BST2 is 30-36 kDa (PMID: 19196977; 21237475). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg1961 Product name: Recombinant Human BST2 protein (rFc Tag) Source: mammalian cells -derived, pHZ-KIsec-N-rFc Tag: N-rFc Domain: 49-161 aa of BC033873 Sequence: NSEACRDGLRAVMECRNVTHLLQQELTEAQKGFQDVEAQAATCNHTVMALMASLDAEKAQGQKKVEELEGEITTLNHKLQDASAEVERLRRENQVLSVRIADKKYYPSSQDSS Predict reactive species Full Name: bone marrow stromal cell antigen 2 Calculated Molecular Weight: 180 aa, 20 kDa GenBank Accession Number: BC033873 Gene Symbol: BST2 Gene ID (NCBI): 684 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q10589 Storage Buffer: PBS with 0.09% sodium azide, pH 7.3. Storage Conditions: Store at 2 - 8°C. Stable for one year after shipment.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924