Proteintech, 98339-3-RR, Anti-Human KIR2DS4/CD158i Rabbit Recombinant Antibody

Size: 100ug The KIR2DS4/CD158i (98339-3-RR) by Proteintech is a Recombinant antibody targeting KIR2DS4/CD158i in FC applications with reactivity to human samples 98339-3-RR targets KIR2DS4/CD158i in FC applications and shows reactivity with human samples. Tested Applications Positive FC detected in: human peripheral blood leukocyte Recommended dilution Flow Cytometry (FC): FC : 0.25 ug per 10^6 cells in a 100 µl suspension Background Information KIR2DS4 (also known as CD158i) is a member of the killer cell immunoglobulin-like receptor (KIR) family. KIRs are transmembrane glycoproteins expressed by natural killer cells and subsets of T cells. KIRs are mainly involved in inhibiting NK killing (inhibitory KIRs) via interaction with MHC class I molecules. KIR2DS4 has been reported to be an activating KIR and recognize the HLA-Cw4 protein. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg4353 Product name: Recombinant Human KIR2DS4 protein (rFc Tag) Source: mammalian cells -derived, V37 Tag: C-rFc Domain: 22-245 aa of NM_012314.6 Sequence: QEGVHRKPSFLALPGHLVKSEETVILQCWSDVMFEHFLLHREGKFNNTLHLIGEHHDGVSKANFSIGPMMPVLAGTYRCYGSVPHSPYQLSAPSDPLDMVIIGLYEKPSLSAQPGPTVQAGENVTLSCSSRSSYDMYHLSREGEAHERRLPAVRSINGTFQADFPLGPATHGGTYRCFGSFRDAPYEWSNSSDPLLVSVTGNPSNSWPSPTEPSSKTGNPRHLH Predict reactive species Full Name: killer cell immunoglobulin-like receptor, two domains, short cytoplasmic tail, 4 Calculated Molecular Weight: 34 kDa GenBank Accession Number: NM_012314.6 Gene Symbol: KIR2DS4 Gene ID (NCBI): 3809 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P43632 Storage Buffer: PBS with 0.09% sodium azide, pH 7.3. Storage Conditions: Store at 2 - 8°C. Stable for one year after shipment.