Proteintech, 98348-1-RR, Anti-Mouse SLAM/CD150 Rabbit Recombinant Antibody

Size: 100ug The SLAM/CD150 (98348-1-RR) by Proteintech is a Recombinant antibody targeting SLAM/CD150 in FC applications with reactivity to mouse samples 98348-1-RR targets SLAM/CD150 in FC applications and shows reactivity with mouse samples. Tested Applications Positive FC detected in: mouse splenocytes Recommended dilution Flow Cytometry (FC): FC : 0.25 ug per 10^6 cells in a 100 µl suspension Background Information Signaling lymphocytic activation molecule (SLAM, also known as SLAMF1 or CD150) is a 70-95 kDa transmembrane glycoprotein that belongs to the immunoglobulin gene superfamily. SLAM is constitutively expressed on peripheral blood memory T-cells, T-cell clones, immature thymocytes and a proportion of B-cells, and is rapidly induced on naive T-cells after activation. SLAM is involved in T cell stimulation and cytokine production, and may play an important role in the regulation of immune responses to pathogens. Specification Tested Reactivity: mouse Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg2787 Product name: Recombinant Mouse SLAM/CD150 protein (rFc Tag) (HPLC verified) Source: mammalian cells -derived, V37 Tag: C-rFc Domain: 25-242 aa of NM_013730.4 Sequence: TGGGVMDCPVILQKLGQDTWLPLTNEHQINKSVNKSVRILVTMATSPGSKSNKKIVSFDLSKGSYPDHLEDGYHFQSKNLSLKILGNRRESEGWYLVSVEENVSVQQFCKQLKLYEQVSPPEIKVLNKTQENENGTCSLLLACTVKKGDHVTYSWSDEAGTHLLSRANRSHLLHITLSNQHQDSIYNCTASNPVSSISRTFNLSSQACKQESSSESSP Predict reactive species Full Name: signaling lymphocytic activation molecule family member 1 Calculated Molecular Weight: 38 kDa GenBank Accession Number: NM_013730.4 Gene Symbol: Slamf1 Gene ID (NCBI): 27218 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q9QUM4-1 Storage Buffer: PBS with 0.09% sodium azide, pH 7.3. Storage Conditions: Store at 2 - 8°C. Stable for one year after shipment.