Iright
BRAND / VENDOR: Proteintech

Proteintech, 98352-1-RR, Anti-Mouse IL-5 Rabbit Recombinant Antibody

CATALOG NUMBER: 98352-1-RR
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 100ug The IL-5 (98352-1-RR) by Proteintech is a Recombinant antibody targeting IL-5 in FC (Intra) applications with reactivity to mouse samples 98352-1-RR targets IL-5 in FC (Intra) applications and shows reactivity with mouse samples. Tested Applications Positive FC (Intra) detected in: C57BL/6 Th2-polarized splenocytes Recommended dilution Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.13 ug per 10^6 cells in 100 μl suspension Background Information Interleukin-5 (IL-5) is a critical cytokine that regulates the growth, activation, and survival of eosinophils. IL-5 is produced by both hematopoietic and non-hematopoietic cells including T cells, granulocytes, and natural helper cells. IL-5 exerts its effects for proliferation and differentiation via receptors that comprise an IL-5-specific α and common β-subunit. Overexpression of IL-5 in vivo significantly increases eosinophils and B cells in number, while mice lacking a functional gene for IL-5 or IL-5 receptor display a number of developmental and functional impairments in B cells and eosinophil lineages. Specification Tested Reactivity: mouse Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg0223 Product name: Recombinant Mouse IL-5 protein (His Tag) Source: mammalian cells -derived, pHZ-KIsec-C-6*HIS Tag: C-6*HIS Domain: 21-133 aa of NM_010558 Sequence: MEIPMSTVVKETLTQLSAHRALLTSNETMRLPVPTHKNHQLCIGEIFQGLDILKNQTVRGGTVEMLFQNLSLIKKYIDRQKEKCGEERRRTRQFLDYLQEFLGVMSTEWAMEG Predict reactive species Full Name: interleukin 5 Calculated Molecular Weight: 15 aa GenBank Accession Number: NM_010558 Gene Symbol: Il5 Gene ID (NCBI): 16191 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P04401 Storage Buffer: PBS with 0.09% sodium azide, pH 7.3. Storage Conditions: Store at 2 - 8°C. Stable for one year after shipment.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924