Proteintech, 98363-1-RR, Anti-Human IL-3 Rabbit Recombinant Antibody

Size: 100ug The IL-3 (98363-1-RR) by Proteintech is a Recombinant antibody targeting IL-3 in FC (Intra) applications with reactivity to human samples 98363-1-RR targets IL-3 in FC (Intra) applications and shows reactivity with human samples. Tested Applications Positive FC (Intra) detected in: PMA, Ionomycin and Brefeldin A treated human PBMCs Recommended dilution Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension Background Information Interleukin-3 (IL-3) is a multilineage hematopoietic growth factor that promotes the proliferation, differentiation and survival of early multilineage hematopoietic progenitors. In particular, this cytokine plays a key role in stimulating the proliferation and survival of myeloid precursors. It is involved in a variety of cell activities such as cell growth, differentiation and apoptosis. This cytokine has been shown to also possess neurotrophic activity, and it may be associated with neurologic disorders. (PMID: 24103757;2698876;2809196) Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg0829 Product name: Recombinant Human IL-3 protein (His Tag) Source: mammalian cells -derived, pHZ-KIsec-C-6*HIS Tag: C-6*HIS Domain: 20-152 aa of NM_000588.3 Sequence: APMTQTTPLKTSWVNCSNMIDEIITHLKQPPLPLLDFNNLNGEDQDILMENNLRRPNLEAFNRAVKSLQNASAIESILKNLLPCLPLATAAPTRHPIHIKDGDWNEFRRKLTFYLKTLENAQAQQTTLSLAIF Predict reactive species Full Name: interleukin 3 (colony-stimulating factor, multiple) Calculated Molecular Weight: 17 kDa GenBank Accession Number: NM_000588.3 Gene Symbol: IL-3 Gene ID (NCBI): 3562 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P08700 Storage Buffer: PBS with 0.09% sodium azide, pH 7.3. Storage Conditions: Store at 2 - 8°C. Stable for one year after shipment.