Proteintech, 98364-2-RR, Anti-Human IL-33 Rabbit Recombinant Antibody

Size: 100ug The IL-33 (98364-2-RR) by Proteintech is a Recombinant antibody targeting IL-33 in FC (Intra) applications with reactivity to human samples 98364-2-RR targets IL-33 in FC (Intra) applications and shows reactivity with human samples. Tested Applications Positive FC (Intra) detected in: human PBMCs Recommended dilution Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension Background Information IL-33 is an IL-1 family cytokine and nuclear alarmin, is constitutively expressed in epithelial barrier tissues and human blood vessels. IL-33 is involved in the maturation of Th2 cells and the activation of mast cells, basophils, eosinophils and natural killer cells. It also acts as a chemoattractant for Th2 cells, and may function as an "alarmin", that amplifies immune responses during tissue injury. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg7061 Product name: Recombinant human IL33 protein Source: mammalian cells -derived, pHZ-KIsec-N-rFc Tag: N-rFc Domain: 122-270 aa of BC047085 Sequence: YLASLSTYNDQSITFALEDESYEIYVEDLKKDEKKDKVLLSYYESQHPSNESGDGVDGKMLMVTLSPTKDFWLHANNKEHSVELHKCEKPLPDQAFFVLHNMHSNCVSFECKTDPGVFIGVKDNHLALIKVDSSENLCTENILFKLSET Predict reactive species Full Name: interleukin 33 Calculated Molecular Weight: 30 kDa GenBank Accession Number: BC047085 Gene Symbol: IL-33 Gene ID (NCBI): 90865 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: O95760 Storage Buffer: PBS with 0.09% sodium azide, pH 7.3. Storage Conditions: Store at 2 - 8°C. Stable for one year after shipment.