Iright
BRAND / VENDOR: Proteintech

Proteintech, 98371-1-RR, Anti-Human CD336 Rabbit Recombinant Antibody

CATALOG NUMBER: 98371-1-RR
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 100ug The CD336 (98371-1-RR) by Proteintech is a Recombinant antibody targeting CD336 in FC applications with reactivity to human samples 98371-1-RR targets CD336 in FC applications and shows reactivity with human samples. Tested Applications Positive FC detected in: Transfected HEK-293T cells Recommended dilution Flow Cytometry (FC): FC : 0.25 ug per 10^6 cells in 100 μl suspension Background Information CD336, also named as NCR2, LY95 and NKp44, belongs to the natural cytotoxicity receptor (NCR) family. It is cytotoxicity-activating receptor that may contribute to the increased efficiency of activated natural killer (NK) cells to mediate tumor cell lysis. It is expressed on activated human NK cells. CD336 displays a single extracellular Ig-like V domain and a transmembrane portion containing the charged residue (Lysine), likely involved in the association with KARAP/DAP12 molecules. The antibody is specific to CD336. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg1594 Product name: Recombinant Human CD336 protein (rFc Tag) Source: mammalian cells -derived, pHZ-KIsec-C-rFc Tag: C-rFc Domain: 22-190 aa of NM_004828 Sequence: QSKAQVLQSVAGQTLTVRCQYPPTGSLYEKKGWCKEASALVCIRLVTSSKPRTMAWTSRFTIWDDPDAGFFTVTMTDLREEDSGHYWCRIYRPSDNSVSKSVRFYLVVSPASASTQTSWTPRDLVSSQTQTQSCVPPTAGARQAPESPSTIPVPSQPQNSTLRPGPAAP Predict reactive species Full Name: natural cytotoxicity triggering receptor 2 Calculated Molecular Weight: 31 kDa GenBank Accession Number: NM_004828 Gene Symbol: CD336 Gene ID (NCBI): 9436 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: O95944 Storage Buffer: PBS with 0.09% sodium azide, pH 7.3. Storage Conditions: Store at 2 - 8°C. Stable for one year after shipment.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924