Proteintech, 98381-1-RR, Anti-Mouse OX40L/TNFSF4 Rabbit Recombinant Antibody

Size: 100ug The OX40L/TNFSF4 (98381-1-RR) by Proteintech is a Recombinant antibody targeting OX40L/TNFSF4 in FC applications with reactivity to mouse samples 98381-1-RR targets OX40L/TNFSF4 in FC applications and shows reactivity with mouse samples. Tested Applications Positive FC detected in: Anti-IgM and CD40 treated BALB/c mouse splenocytes Recommended dilution Flow Cytometry (FC): FC : 0.25 ug per 10^6 cells in 100 μl suspension Background Information The tumour necrosis factor ligand superfamily member 4 gene (TNFSF4, OX40L), which encodes for the T cell costimulatory molecule OX40 ligand, has been identified as a susceptibility gene for the development of systemic lupus erythematosus (SLE). OX40L/TNFSF4/CD252 is a co-stimulatory checkpoint protein expressed by several types of immune and non-immune cells (PMID: 15750594, 19778912). TNFSF4 mRNA is expressed in melanoma cell lines and melanoma samples, including those with low lymphocytic infiltrates, and is not associated with the ulceration status of the primary tumor (PMID: 31501955). Specification Tested Reactivity: mouse Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg1573 Product name: Recombinant Mouse OX40L/TNFSF4 protein (rFc Tag) Source: mammalian cells -derived, pHZ-KIsec-N-rFc Tag: N-rFc Domain: 51-198 aa of NM_009452.2 Sequence: SSSPAKDPPIQRLRGAVTRCEDGQLFISSYKNEYQTMEVQNNSVVIKCDGLYIIYLKGSFFQEVKIDLHFREDHNPISIPMLNDGRRIVFTVVASLAFKDKVYLTVNAPDTLCEHLQINDGELIVVQLTPGYCAPEGSYHSTVNQVPL Predict reactive species Full Name: tumor necrosis factor (ligand) superfamily, member 4 Calculated Molecular Weight: 22kDa GenBank Accession Number: NM_009452.2 Gene Symbol: Tnfsf4 Gene ID (NCBI): 22164 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P43488 Storage Buffer: PBS with 0.09% sodium azide, pH 7.3. Storage Conditions: Store at 2 - 8°C. Stable for one year after shipment.